ࡱ> z/`     '  0 !"#.$%&()*+,-us123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Root Entry FMknf@HBExE(H @H< B3BAhD&G@HNED5H + !"#$%&'()*+,-./01235:789;<A>?@DCEFGHIJKQMNORSUVWXY[\]^_`abcdhjklmqrstuvwxyz{|}~  !"M !"#$%&'()*+,-./yz{|}~܅݅ޅ߅ABCDEFGH mnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno)pqrstuvwxyz{|}~     @HA7CrDBE h@H<AE B3BAhD&G# @HDED/H =@H CCB &R)*9?JOSkx *9QUW]c2222222222222222(22222222222222222222222222(22 2222222ww\bwwwwww\wwww,wAwbwwwQWQGgGgEGGGGEGGGG!!!!!!!!!!!!!!!!m!!!!no!!!!:Kly?AMMMM/=ADFIKMOB<>@DFI<>@iNPRTVNZ\^`dfh@ <>@iqsw>@i<N|@iN>I@@<>@iNP<>@iN@@I<<>@iN @IB<@iP>N@!#%')-'!1i48@<>@BEGJLNP<>@RSTVX@i<>[N_>@I<a<>@idfN=?:=QKO:S??=?o:l?y=;=?:=?:m?y?=?::O?0,6+:=?ACFHKMO?:=?y??^==?p: ((FZ ' i72 ,::>>>>>>>>SSSUUUUbbbbb~~VVVCENP-JL( <@HA0C;;B&F7BB4FhD&B8;`@HBExE(;2DD1BE6HT   !#$%&'( $&', -.0/1234 567855?65ghi34 jklq6q0"#$0:5?123468:0Vbk_ji::@HC/BP@H<AB>(E8BEAn @HDDrDhD7H0@HYEDhE7G E, : :,,5  975 >9<= xș܅ 5# KOPqRSMNV,WKX[Z gebi .lmK:KK&&@HHHH&HHH&H&HH2H22HH@@H@H222HHHH22@ HHHH22H@HAEFAE(?(E8BA(HZ*@H?CAED1H! (@H?dA/B6H v@H?;C8DE %4H@@2HH222H HH&HHHHHH&HHH  H H@HH HHHHH& &HH&H&HHHHHHHHHHHHH&H HHHHHHHHHHH&H&H!&HHHHHHHn~  "+/5.;gp"(9>SUb~8"6Esv&Oh+'0xt|   Installation Database!NI LabVIEW 2012 Real-Time NBFifoNational Instruments InstallerjThis ins%K  H&5.;gp"(9>SUb~ ~"(9>SUb~HV\bhntz #*]bdo: <   " ' 0 2 A P _    5 < A B g u z > A J Q h k r    , 0 5 : ? V X ` h s z }  #$+469:  $  *  6XW_ !"#&')*,36778899::;;<=>?@ABCDEEFFRQGIKONTVWX\^\degijklnp%rs)t+uwxy/0{}39;=FMNQVnx///W]ciou{$+/ CGTcp> @   # ( 1 3 B Q `     6 C D \ ] k v | @ s    - 1 6 ; @ W Y a i u { ~   %-57$  *  4 WY[` !"#i.$'*,3778899::;;<=>?@ABCDEEFFGIONRQTVWX[\^\_`abeipqqs)t+uw/0{}39;=FMNQjlnk cJ5vz~VX   6 8 ^ ` f g      * / ; @ J O Y ^ w x   Z [ m f  % + o ghshtabbb(( bbbbbbbbbbcdcdcdeeeeeeeffeeffeeffeeffeeffefefefefefefefeeeeffeeffijklmnopqeeeeer'#$%&'( $&', -.0/1234 5678] """] `]^_ \["#$0:5?123468:0V"'*-03:AKSUY[_aegkmqswy} &-1379;=?APV_fktx|   &8:DFnpr " $ B D N P y { }     % , 5 8 = D G L S V [ b c k l  taller database contains the logic and data required to install NI LabVIEW 2012 Real-Time NBFifo. @H??wElDj>D/HdZ@H??wElDj;E$H @H C1A5G  0 C1A5GEAB5ABA4a.      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_abcefghijklmnopqrstuvwxyz{|}~e NBFifo)]ErrorMessage{{Fatal error: }}Error [1]. Warning [1]. Info [1]. Internal Error [1]. [2]{, [3]}{, [4]}{{Disk full: }}Action [Time]: [1]. [2][ProductName]{[2]}{, [3]}{, [4]}Message type: [1], Argument: [2]=== Logging started: [Date] [Time] ====== Logging stopped: [Date] [Time] ===Action start [Time]: [1].Action ended [Time]: [1]. Return value [2].Time remaining: {[1] minutes }{[2] seconds}Out of memory. Shut down other applications before retrying.Installer is no longer responding.Installer terminated prematurely.Please wait while Windows configures [ProductName]Gathering required information...{[ProductName] }Setup completed successfully.{[ProductName] }Setup failed.A later version of this product already is installed on this computer.Error reading from file: [2]. {{ System error [3].}} Verify that the file exists and that you can access it.Cannot create the file '[2]'. A directory with this name already exists. Cancel the install and try installing to a different location.Please insert the disk: [2]The installer has insufficient privileges to access this directory: [2]. The installation cannot continue. Log on as administrator or contact your system administrator.Error writing to file: [2]. Verify that you have access to that directory.Error reading from file: [2]. Verify that the file exists and that you can access it.Another application has exclusive access to the file '[2]'. Please shut down all other applications, then click Retry.There is not enough disk space to install this file: [2]. Free some disk space and click Retry, or click Cancel to exit.Source file not found: [2]. Verify that the file exists and that you can access it.Error reading from file: [3]. {{ System error [2].}} Verify that the file exists and that you can access it.Error writing to file: [3]. {{ System error [2].}} Verify that you have access to that directory.Source file not found{{(cabinet)}}: [2]. Verify that the file exists and that you can access it.Cannot create the directory '[2]'. A file with this name already exists. Please rename or remove the file and click retry, or click Cancel to exit.The volume [2] is currently unavailable. Please select another.The specified path '[2]' is unavailable.Unable to write to the specified folder: [2].A network error occurred while attempting to read from the file: [2]An error occurred while attempting to create the directory: [2]A network error occurred while attempting to create the directory: [2]A network error occurred while attempting to open the source file cabinet: [2]The specified path is too long: [2]The Installer has insufficient privileges to modify this file: [2].A portion of the folder path '[2]' exceeds the length allowed by the system.The folder path '[2]' contains words that are not valid in folder paths.The folder path '[2]' contains an invalid character.'[2]' is not a valid short file name.Error getting file security: [3] GetLastError: [2]Invalid Drive: [2]Could not create key: [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel. Could not open key: [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel. Could not delete value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel. Could not delete key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel. Could not read value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel. Could not write value [2] to key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get value names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get sub key names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not read security information for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not increase the available registry space. [2] KB of free registry space is required for the installation of this application.Another installation is in progress. You must complete that installation before continuing this one.Error accessing secured data. Please make sure the Windows installer is configured properly and try the install again.User '[2]' has previously initiated an install for product '[3]'. That user will need to run that install again before they can use that product. Your current install will now continue.User '[2]' has previously initiated an install for product '[3]'. That user will need to run that install again before they can use that product.Out of disk space -- Volume: '[2]'; required space: [3] KB; available space: [4] KB. Free some disk space and retry.Are you sure you want to cancel?The file [2][3] is being held in use{ by the following process: Name: [4], Id: [5], Window Title: '[6]'}. Close that application and retry.The product '[2]' is already installed, preventing the installation of this product. The two products are incompatible.Out of disk space -- Volume: '[2]'; required space: [3] KB; available space: [4] KB. If rollback is disabled, enough space is available. Click 'Cancel' to quit, 'Retry' to check available disk space again, or 'Ignore' to continue without rollback.Could not access network location [2].The following applications should be closed before continuing the install:Could not find any previously installed compliant products on the machine for installing this product.The key [2] is not valid. Verify that you entered the correct key.The installer must restart your system before configuration of [2] can continue. Click Yes to restart now or No if you plan to manually restart later.You must restart your system for the configuration changes made to [2] to take effect. Click Yes to restart now or No if you plan to manually restart later.An installation for [2] is currently suspended. You must undo the changes made by that installation to continue. Do you want to undo those changes?A previous installation for this product is in progress. You must undo the changes made by that installation to continue. Do you want to undo those changes?No valid source could be found for product [2]. The Windows installer cannot continue.Installation operation completed successfully.Installation operation failed.Product: [2] -- [3]You may either restore your computer to its previous state or continue the install later. Would you like to restore?An error occurred while writing installation information to disk. Check to make sure enough disk space is available, and click Retry, or Cancel to end the install.One or more of the files required to restore your computer to its previous state could not be found. Restoration will not be possible.The path [2] is not valid. Please specify a valid path.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to go back to the previously selected volume.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to return to the browse dialog and select a different volume.The folder [2] does not exist. Please enter a path to an existing folder.You have insufficient privileges to read this folder.A valid destination folder for the install could not be determined.Error attempting to read from the source install database: [2].Scheduling reboot operation: Renaming file [2] to [3]. Must reboot to complete operation.Scheduling reboot operation: Deleting file [2]. Must reboot to complete operation.Module [2] failed to register. HRESULT [3]. Contact your support personnel.Module [2] failed to unregister. HRESULT [3]. Contact your support personnel.Failed to cache package [2]. Error: [3]. Contact your support personnel.Could not register font [2]. Verify that you that you have sufficient permissions to install fonts, and that the system supports this font.Could not unregister font [2]. Verify that you that you have sufficient permissions to remove fonts.Could not create Shortcut [2]. Verify that the destination folder exists and that you can access it.Could not remove Shortcut [2]. Verify that the shortcut file exists and that you can access it.Could not register type library for file [2]. Contact your support personnel.Could not unregister type library for file [2]. Contact your support personnel.Could not update the ini file [2][3]. Verify that the file exists and that you can access it.Could not schedule file [2] to replace file [3] on reboot. Verify that you have write permissions to file [3].Error removing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error installing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error removing ODBC driver: [4], ODBC error [2]: [3]. Verify that you have sufficient privileges to remove ODBC drivers.Error installing ODBC driver: [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Error configuring ODBC data source: [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Service '[2]' ([3]) failed to start. Verify that you have sufficient privileges to start system services.Service '[2]' ([3]) could not be stopped. Verify that you have sufficient privileges to stop system services.Service '[2]' ([3]) could not be deleted. Verify that you have sufficient privileges to remove system services.Service '[2]' ([3]) could not be installed. Verify that you have sufficient privileges to install system services.Could not update environment variable '[2]'. Verify that you have sufficient privileges to modify environment variables.You do not have sufficient privileges to complete this installation for all users of the machine. Log on as administrator and then retry this installation.Could not set file security for file '[3]'. Error: [2]. Verify that you have sufficient priviliges to modify the security permissions for this file.ActionTextActionTemplateBindImageBinding executablesFile: [1]AllocateRegistrySpaceAllocating registry spaceFree space: [1]AppSearchSearching for installed applicationsProperty: [1], Signature: [2]AdvertiseAdvertising applicationCostFinalizeComputing space requirementsCostInitializeCreateFoldersCreating foldersFolder: [1]CreateShortcutsCreating shortcutsShortcut: [1]DeleteServicesDeleting servicesService: [1]DuplicateFilesCreating duplicate filesFile: [1], Directory: [9], Size: [6]UnpublishProductUnpublishing product informationFileCostInstallAdminPackageCopying network install filesFile: [1], Directory: [9], Size: [6]InstallFilesCopying new filesInstallODBCInstalling ODBC componentsInstallServicesInstalling new servicesService: [2]InstallValidateValidating installLaunchConditionsEvaluating launch conditionsMoveFilesMoving filesPatchFilesPatching filesFile: [1], Directory: [2], Size: [3]ProcessComponentsUpdating component registrationPublishComponentsPublishing Qualified ComponentsComponent ID: [1], Qualifier: [2]PublishFeaturesPublishing Product FeaturesFeature: [1]PublishProductPublishing product informationRegisterClassInfoRegistering Class serversClass Id: [1]RegisterExtensionInfoRegistering extension serversExtension: [1]RollbackRolling back action:[1]UnmoveFilesRemoving moved filesFile: [1], Directory: [9]RegisterFontsRegistering fontsFont: [1]RegisterMIMEInfoRegistering MIME infoMIME Content Type: [1], Extension: [2]RollbackCleanupRemoving backup filesRegisterProductRegistering productRegisterProgIdInfoUnregistering program identifiersProgId: [1]RegisterTypeLibrariesRegistering type librariesLibID: [1]RegisterUserRegistering userRemoveDuplicateFilesRemoving duplicated filesRemoveEnvironmentStringsUpdating environment stringsName: [1], Value: [2], Action [3]RemoveFilesRemoving filesRemoveFoldersRemoving foldersRemoveIniValuesRemoving INI files entriesFile: [1], Section: [2], Key: [3], Value: [4]GenerateScriptGenerating script operations for action:RemoveODBCRemoving ODBC componentsRemoveRegistryValuesRemoving system registry valuesKey: [1], Name: [2]RemoveShortcutsRemoving shortcutsSelfRegModulesRegistering modulesFile: [1], Folder: [2]SelfUnregModulesUnregistering modulesSetODBCFoldersInitializing ODBC directoriesODBC Driver [1] forcing folder [2] to [3]StartServicesStarting servicesStopServicesStopping servicesUnpublishComponentsUnpublishing Qualified ComponentsUnpublishFeaturesUnpublishing Product FeaturesUnregisterClassInfoUnregister Class serversUnregisterExtensionInfoUnregistering extension serversUnregisterFontsUnregistering fontsUnregistering fontsUnregisterMIMEInfoUnregistering MIME infoUnregisterProgIdInfoUnregisterTypeLibrariesUnregistering type librariesWriteEnvironmentStringsWriteIniValuesWriting INI files valuesWriteRegistryValuesWriting system registry valuesKey: [1], Name: [2], Value: [3]BinaryDataNIPartDependencyDependencyUpgradeCodeNIFeatureSubsetVersionMinVersionMaxLanguages{5B0CB826-E499-4E6B-94F0-75B6327ED934}{BE400A3D-E9D6-48D9-AF14-337722A11D40}UpgradeLanguageRemoveActionPropertyControlDialog_XYWidthHeightPropertyTextControl_NextHelpWelcome_DialogNextPushButton{&MSSansSerif8}&Next >Previous{&MSSansSerif8}< &BackCancel{&MSSansSerif8}&CancelProductName{&Arial14}[ProductName] SetupText1{&MSSansSerif8}Exit all Windows programs before running this setup program.Text2{&MSSansSerif8}This program is protected by copyright law and international treaties. By installing this software you accept the accompanying license agreement(s).LineBitmapsidegraphicSelect_Feature_DialogTreeSelectionTree_BrowseProperty{&MSSansSerif8}Browse{&MSSansSerif8}Br&owseReset{&MSSansSerif8}&ResetDiskCost{&MSSansSerif8}&Disk CostText23{&Arial8}Select FeaturesText49Line21Text41{&Arial8}Feature Description:ItemDescription{&MSSansSerif8}Multiline description of the currently selected item xxx xxxx xxxx xxxx xxxx xxxxx xxx xxxx xxxx xxxx xxx xxxx xx xxxxx xxxxx xActionDescription{&MSSansSerif8}Description of the currently selected action xxx xxx xxx xxxx xxxx xxxx xxxx xxxxSize{&MSSansSerif8}The size of the current selection xxx xxx xxxx xxxx xxxx xxxx xxx xxxx xxxx xxxx xxxx xxxLocationFrameGroupBoxLocationPath{&MSSansSerif8}PathLocationText{&MSSansSerif8}Current location:Text24{&MSSansSerif8}Please select which features you would like to install.topgraphicSelectionFrameLicense_DialogGroupRadioButtonGroupLVRT_00\LVRT_00_fra.mstLicenseScrollableText{\rtf1\ansi\ansicpg1252\deff0\deflang1033\deflangfe1041{\fonttbl{\f0\fswiss\fprq2\fcharset0 Arial;}{\f1\fswiss\fprq2\fcharset0 Calibri;}} {\colortbl ;\red0\green0\blue255;\red0\green0\blue0;} {\*\generator Msftedit 5.41.21.2510;}\viewkind4\uc1\pard\nowidctlpar\fi-360\li710\sb100\sa240\qc\b\f0\fs24 NATIONAL INSTRUMENTS SOFTWARE LICENSE AGREEMENT\par \pard\nowidctlpar\sb100\sa240\qj\b0\fs18 INSTALLATION NOTICE: THIS IS A CONTRACT. BEFORE YOU DOWNLOAD THE SOFTWARE AND/OR COMPLETE THE INSTALLATION PROCESS, CAREFULLY READ THIS AGREEMENT. BY DOWNLOADING THE SOFTWARE AND/OR CLICKING THE APPLICABLE BUTTON TO COMPLETE THE INSTALLATION PROCESS, YOU CONSENT TO THE TERMS OF THIS AGREEMENT AND YOU AGREE TO BE BOUND BY THIS AGREEMENT. IF YOU DO NOT WISH TO BECOME A PARTY TO THIS AGREEMENT AND BE BOUND BY ALL OF ITS TERMS AND CONDITIONS, CLICK THE APPROPRIATE BUTTON TO CANCEL THE INSTALLATION PROCESS, DO NOT INSTALL OR USE THE SOFTWARE, AND RETURN THE SOFTWARE WITHIN THIRTY (30) DAYS OF RECEIPT OF THE SOFTWARE (WITH ALL ACCOMPANYING WRITTEN MATERIALS, ALONG WITH THEIR CONTAINERS) TO THE PLACE YOU OBTAINED THEM. ALL RETURNS SHALL BE SUBJECT TO NI\u8242?S THEN CURRENT RETURN POLICY. \par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 1.\tab\ul Definitions.\ulnone As used in this Agreement, the following terms have the following meanings: \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj A.\tab\ul\i "Academic Institution."\ulnone\i0 Means a degree-granting educational institution. \par B.\tab\ul\i "Activity Compliance Logs."\ulnone\i0 Means the reports and other applicable information generated by the NI VLM in connection with a Volume License Program (VLP) and/or Enterprise Program (EP) in which you participate. If the Approved Volume License Manager is not the NI VLM, or the SOFTWARE is not compatible with an Approved Volume License Manager, then you are responsible for obtaining the form of report acceptable to NI (which, in such case only, shall be an "Activity Compliance Log"), and manually completing and delivering that report to NI. \par C.\tab\ul\i "Agreement."\ulnone\i0 Means this National Instruments Software License Agreement, together with any and all applicable Specific Product Addenda.\par D.\tab\ul\i "Approved Volume License Manager."\ulnone\i0 Means the NI VLM or FLEXnet or FLEXlm software or any other third party computer software approved in writing by NI for controlling end-user access to the SOFTWARE.\par \pard\nowidctlpar\fi-357\li714\sb100\sa240\qj E.\tab\ul\i "Authorized Applications."\ulnone\i0 Means (i) those applications that you create with development versions of the SOFTWARE that you have validly licensed (including such applications that you create with third party software using real-time operating system components of the LabVIEW Real-Time Module and the LabWindows/CVI Real-Time Module in accordance with the licenses for such modules), and (ii) those applications that you create with third party software development environments and that utilize Driver Interface Software, if such software development environment is supported by such Driver Interface Software as indicated in the applicable Documentation for such Driver Interface Software. Notwithstanding the foregoing, (a) any application created with the Measurement Studio SOFTWARE is not an Authorized Application if it uses any Measurement Studio controls in a "design time" context, and (b) any application created with any SOFTWARE acquired under an evaluation license is not an Authorized Application.\par F.\tab\ul\i "Computer"\ulnone\i0 or\i \ul "computer."\ulnone\i0 Refers to one computing device or, if the SOFTWARE is being used in connection with a virtual machine, one virtual machine on one computing device.\par \pard\fi-357\li714 G.\tab\ul\i "Driver Interface Software\i0 .\i "\ulnone\i0 Means computer software and other code provided with this Agreement that are listed as hardware drivers or device drivers on NI\u8242?s hardware driver listing web page, which web page is currently located at the following URL, or are added by NI at any time to such listing or any similar successor listings: \f1\fs22{\field{\*\fldinst{HYPERLINK "http://www.ni.com/driverinterfacesoftware"}}{\fldrslt{\ul\f0\fs18 www.ni.com/driverinterfacesoftware}}}\ulnone\f0\fs18 ; together with all accompanying documentation and utilities. In no event, however, shall the term "Driver Interface Software" ever include any Third Party Software (as defined below), operating system software, instrument driver software, application software, toolkits, modules, or any driver development kit (DDK) or portion thereof, software development kit (SDK) or portion thereof, module development kit (MDK) or portion thereof, or any software or other code designated by NI as being any of the foregoing; or any accompanying documentation or utilities. \par \pard\nowidctlpar\fi-357\li714\sb100\sa240\qj H.\tab\ul\i "Excluded License\i0 .\i "\ulnone\i0 Means a license that requires, or purports to require, as a condition of use, modification, or distribution, that (i) the code that is or could become subject to the license, be disclosed or distributed in source code form, or (ii) others have the right to modify or create derivative works of the code that is or could become subject to the license.\par I.\tab\ul\i "Instructor."\ulnone\i0 Means an individual teaching at an Academic Institution. \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj J.\tab\ul\i "NI."\ulnone \i0 Means National Instruments Corporation, a company organized under the laws of the State of Delaware, U.S.A., unless the SOFTWARE is manufactured in the Republic of Ireland, in which event, "NI" shall mean National Instruments Ireland Resources Ltd., a company organized under the laws of the Republic of Ireland. If you are not sure where the SOFTWARE is manufactured, please contact National Instruments Corporation, 11500 N. Mopac Expressway, Austin, Texas, U.S.A. 78759-3504 (Attention: Legal Department).\par \pard\nowidctlpar\fi-350\li710\sb100\sa240\qj\tx710 K.\tab\ul\i "NI VLM."\ulnone\i0 Means NI\u8242?s computer software for controlling end-user access to the SOFTWARE and that generates applicable usage compliance information, including the Activity Compliance Logs.\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj L.\tab\ul\i "Scripting\i0 .\i "\ulnone\i0 Means the VI server methods, functions and properties made visible or otherwise available in the NI LabVIEW Software Editor by enabling VI Scripting methods and properties in the \b Tools\'bbOptions\b0 menu.\par M.\tab\ul\i "SOFTWARE."\ulnone\i0 Means the computer software and other code provided with this Agreement (including all Upgrades that may be provided by NI as part of the Software Service for which you have paid the applicable fees or as otherwise provided under this Agreement) that you are authorized to install and use in accordance with Section 2 below, together with all accompanying documentation, utilities, and Driver Interface Software. If the SOFTWARE is part of a NI suite product, the term SOFTWARE means all of the applicable NI software programs comprising the applicable suite (including all accompanying documentation, utilities, and Driver Interface Software) that you have acquired. NI provides certain third party software subject to separate license terms either presented at the time of installation or otherwise provided with the SOFTWARE ("Third Party Software"). Such Third Party Software is not included in the definition of the term "SOFTWARE". \par \pard\nowidctlpar\fi-350\li710\sb100\sa240\qj N.\tab\ul\i "Software Administrator(s)."\ulnone\i0 Means the individual(s) in your organization who are responsible for administering a Volume License Program (VLP) and/or Enterprise Program (EP) in which you participate. Each Software Administrator is responsible for distributing and overseeing the installation and use of the master installation disks for the SOFTWARE and the Approved Volume License Manager. \par \pard\nowidctlpar\fi-357\li714\sb100\sa240\qj O.\tab\ul\i "Software Service."\ulnone\i0 Means the maintenance and technical support associated with the SOFTWARE or other software services program, in each case provided by NI and lasting for the duration of time identified in the applicable quote or other offer documentation. The Software Service program is further described in the documentation provided with the Software Services membership and/or, in the case of a VLP License, in the VLP Documentation. \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj P.\tab\ul\i "Specific Product Addendum."\ulnone\i0 Means an addendum to this National Instruments Software License Agreement that is identified as a National Instruments Software License Agreement Product Addendum. A Specific Product Addendum contains terms and conditions which apply with respect to the specific SOFTWARE product(s) identified in the Specific Product Addendum.\par Q.\tab\ul\i "Student."\ulnone\i0 Means an individual enrolled (or taking continuing education classes) at an Academic Institution.\par R.\tab\ul\i "Term."\ulnone\i0 Means the period of time commencing on the date of your clicking the applicable button to complete the installation process and continuing for the period of time specified in the product description or other applicable documentation provided to you by NI, or, if no period of time is specified, perpetually, unless this Agreement is terminated earlier by NI or you as provided herein, in which case such period is deemed to have ended on the effective date of such termination.\par S.\tab\ul\i "Upgrade."\ulnone\i0 Means any supplemental or replacement code for SOFTWARE you have previously licensed from NI.\par T.\tab\ul\i "You."\ulnone\i0 Means you, the individual using the SOFTWARE, as well as your employer, if you are using the SOFTWARE within the scope of your employment. If you are using the SOFTWARE within the scope of your employment, then you represent that you are authorized to bind your employer to this Agreement.\par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 2.\tab\ul Grant of License.\ulnone In consideration of, and conditioned upon, your payment of the applicable fees to NI, NI hereby grants you a limited, non-exclusive right to use (in accordance with one of the license types listed below) the specific SOFTWARE, as such SOFTWARE and license type are identified in the applicable documentation provided by NI to you, but only pursuant and subject at all times to the terms and conditions of this Agreement. Unless otherwise provided in the applicable documentation provided by NI to you, the applicable license type is a named user license as described in Section 2.A. below. While your use rights may extend to a prior version of the SOFTWARE as expressly permitted under Section 6 below, your use rights do not extend to any Upgrades for the applicable SOFTWARE unless such Upgrades are provided to you during the Limited Warranty period noted below in Section 13 or are provided to you as part of the Software Service for which you have paid the applicable fees. The SOFTWARE is in "use" when loaded into temporary memory (i.e., RAM) or installed into permanent memory (e.g., hard disk, CD-ROM, DVD-ROM, network storage device, or other storage device). Except as expressly authorized under this Section 2, floating, concurrent, or shared use is not permitted under this Agreement. The specific use rights granted to you are as follows and depend upon the type of license you have acquired: \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj A.\tab\ul Named User/Computer Based License.\ulnone If you have acquired a named user license, you must designate in writing (through the NI registration process) one (1) of your employees to serve as the named user for the license (the "Named User"). The SOFTWARE may be installed on up to three computers in a single workplace of the designated Named User. Only the designated Named User, however, may use or otherwise run the SOFTWARE, and the SOFTWARE may not be run concurrently (i.e., it may only be launched on one computer at a time). At your discretion, you may convert a named user license to a computer based license. If you have acquired a computer based license or converted a named user license to a computer based license pursuant to this Section 2.A., the SOFTWARE may only be installed and used on one (1) computer in your workplace. In the case of a named user license, if any of the computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, or, in the case of a computer based license, if the single computer is a laptop, notebook or similar portable computer, you may use the SOFTWARE on the portable computer while temporarily away from your workplace for the same purpose permitted by this Agreement as you normally use the SOFTWARE on the portable computer while in your workplace. While all of the SOFTWARE must be installed and used on the same computer under a computer based license, there is no limitation on the number of your employees that may access and use the SOFTWARE on such computer; provided, however, that the SOFTWARE may not be run concurrently (i.e., only one instance of the SOFTWARE can be launched on one computer at a time). Regardless of whether the SOFTWARE is used under a named user license or a computer based license, in no event may any of the SOFTWARE be installed or used on a network storage device. If you have a VLP License or Surviving VLP License and you want to convert named user licenses to computer based licenses, you must give written notice to NI so that NI can send you a new license file reflecting the revised number of licenses of each type; provided that no more than four (4) such conversions may occur per calendar year. You may transfer a named user license to another designated employee provided that no more than four (4) such transfers may occur per calendar year. You may change the designated computer for a computer based license to another computer within the applicable single workplace; provided that no more than four (4) such changes may occur per calendar year and further provided that, immediately following such change, none of the SOFTWARE remains installed on the previously designated computer. Once the named user license for a designated Named User has been transferred to another employee or third party contractor pursuant to Section 2.M. of this Agreement, such named user license must be reregistered with NI to designate the new Named User. Unless otherwise specified by NI in writing, deployment licenses you have acquired in connection with any of the SOFTWARE listed in, or otherwise identified pursuant to, Section 12.B. as being subject to the license verification or distribution authorization requirements stated therein (each such deployment license being referred to as a "Designated Deployment License"), are computer based licenses. \par B.\tab\ul Volume/VLP License.\ulnone If you have acquired the right to use the SOFTWARE for multiple users under the Volume License Program ("VLP"), you shall install and use an Approved Volume License Manager with the most current license file provided to you by NI that controls end-user access to the SOFTWARE licensed under the VLP. During the VLP Term, you may distribute the master installation disk(s) containing the SOFTWARE for internal installation and use by your employees only on those computers located at the Site(s). In addition to being subject to the terms and conditions set forth in Section 2.I., your use of the SOFTWARE under the VLP shall at all times (during the VLP Term and thereafter) also be subject to all terms and conditions set forth in this Agreement regarding the specific type of VLP License you have acquired under the VLP. As part of the VLP, you must, for each individual VLP License, acquire and maintain during the term of the VLP the Software Services for the SOFTWARE identified in the applicable VLP Documentation and for which NI makes such Software Services available.\par \pard\nowidctlpar\fi-350\li710\sb100\sa240\qj\tx710 C. \tab\ul Enterprise Program/EP License.\ulnone In some cases NI makes available licenses and services for certain SOFTWARE to certain customers pursuant to an NI Enterprise Program ("EP"). In such cases NI, or an authorized NI affiliate, and the customer enter into NI Enterprise Program Documentation that, among other things, identifies the SOFTWARE items which are covered under the customer\u8242?s EP; the types and maximum number of the customer\rquote s EP licenses for such SOFTWARE during the EP Term; the types and maximum number of any licenses which the customer will obtain on expiration of the EP Term, and the SOFTWARE to which such licenses will apply; any EP Pre-Existing Licenses to be converted to Term licenses under the customer\rquote s EP for the EP Term; the Software Services which the customer is purchasing, and NI is providing, under the customer\u8242?s EP; and the training and certification service credits which the customer is purchasing, and NI is providing, under the customer\rquote s EP. NI is not obligated to enter into, or to authorize or cause any NI affiliate to enter into, EP Documentation with you or to make the EP or its benefits available you. If NI, or an authorized NI affiliate, and you have entered into EP Documentation, then the following provisions of this Section 2.C., and Section 2.J., apply, and use of the SOFTWARE is subject to the provisions of this Section 2.C. and the terms and conditions set forth in Section 2.J. You shall install and use an Approved Volume License Manager with the most current license file provided to you by NI that controls end-user access to the SOFTWARE licensed pursuant to the EP. During the EP Term, you may distribute the master installation disk(s) containing the SOFTWARE for internal installation and use by your employees only on those computers located at the EP Locations. SOFTWARE may be used under the EP: (a) solely in accordance with the terms and conditions set forth in this Agreement regarding the specific type of license applicable to such license type acquired under the EP, (b) solely at, and on computers located at, the EP Locations, and (c) solely during the EP Term. After the expiration of the EP Term, any and all subsequent use of the SOFTWARE which may be permitted under the EP for which the license Term had not previously terminated shall be as provided in Section 2.J. You acknowledge and agree that: (i) in no event may your use of the SOFTWARE (in the aggregate) under the EP exceed the maximum total number of licenses set forth in the EP Documentation and (ii) no software (including any copies of the SOFTWARE) other than the copies of the SOFTWARE expressly identified in the EP Documentation may be used by you under the EP. \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj D.\tab\ul Concurrent Use License.\ulnone If you have acquired a concurrent use license, you may install the SOFTWARE on any or all computers at the Sites for use by Authorized Users at the Sites; provided, however, in no event may the number of Authorized Users who are accessing and/or running any of the SOFTWARE at the same time (i.e., concurrent users) exceed the Maximum Number of Seats which you have purchased. You agree that you will also use an Approved Volume License Manager and the license file provided by NI that controls end-user access to the SOFTWARE to ensure compliance with the foregoing. Your concurrent use license will automatically terminate if the number of concurrent users of the SOFTWARE at any time exceeds the Maximum Number of Seats which you have purchased. As used herein, the term "Authorized Users" means your employees at the Sites who use the SOFTWARE; for purposes of this Section 2.D. the term "Sites" means and is limited to only the Site (as defined in Section 2.I.(5.)) to which NI initially delivered the SOFTWARE and all of your Sites (as defined in Section 2.I.(5.)) which are located within the same country as that Site; and the term "Maximum Number of Seats" means the number of seats you have acquired as designated in the applicable quote or other documents provided to you by NI. For purposes of the concurrent use license, all Sites (as defined in Section 2.I.(5.)) which are located in a member of the North American Free Trade Agreement or South America shall be considered located in the same country, all Sites (as defined in Section 2.I.(5.)) which are located in Iceland, Norway, Switzerland, Africa or any member country of the European Union shall be considered located in the same country, and all Sites (as defined in Section 2.I.(5.)) which are located in Asia shall be considered located in the same country. \par E.\tab\ul Multiple Access License.\ulnone If you have acquired a multiple access license to use NI-488.2 SOFTWARE for GPIB-ENET hardware products (individually or collectively, "Multiple Access Software"), your employees may install and use the NI-488.2 SOFTWARE on any number of computers or storage devices in your workplace solely for the purpose of accessing Ethernet to GPIB controllers. \cf2 If any of such computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, you may use the SOFTWARE as permitted by this Section 2.E. on the portable computer while temporarily away from your workplace.\cf0\par F.\tab\ul Debug License.\ulnone If you have acquired a debug license, you must have licensed the applicable SOFTWARE components (as identified below) under (i) a separate named user license, computer based license, or VLP License with NI, in which case your applicable employee(s) may now, under the debug license, install such SOFTWARE components on one (1) additional target production computer (for each debug license acquired) for debug purposes only or (ii) a concurrent use license, in which case you may install and use the SOFTWARE for debug purposes only, in accordance with the concurrent use restrictions set forth above. If you licensed the applicable SOFTWARE components under a license other than a concurrent use license, then each of the applicable components must be used on the same target production computer. Debug licenses may only be used for debug purposes. In no event may you use the components for developing new programs (e.g., test sequences/modules, virtual instruments (VIs), etc.). Further, if you acquire any Upgrade to the applicable SOFTWARE, your existing debug license cannot be used with such Upgrade. Rather, you must acquire a separate, "upgraded" debug license from NI for use with such Upgrade. If the SOFTWARE is NI TestStand, then the applicable components are (a) the NI TestStand runtime execution engine for executing your sequences and the complete NI TestStand sequence editor development environment; (b) one (1) copy of LabVIEW and the applicable software toolkits; (c) one (1) copy of LabWindows/CVI and the applicable software toolkits; and (d) one (1) copy of Measurement Studio and the applicable SOFTWARE toolkits. If the SOFTWARE is LabVIEW, then the applicable component is one (1) copy of LabVIEW and the applicable SOFTWARE toolkits. If the SOFTWARE is LabWindows/CVI, then the applicable component is one (1) copy of LabWindows/CVI and applicable SOFTWARE toolkits. If the SOFTWARE is NI SwitchExecutive, then the applicable component is one (1) copy of NI SwitchExecutive\b . \b0 If the SOFTWARE is Measurement Studio, then the applicable component is one (1) copy of Measurement Studio and the applicable SOFTWARE toolkits. If the SOFTWARE is any of the following software, or any other software designated by NI as being software with respect to which NI offers a debug license: LabVIEW Mobile Module, LabVIEW Touch Panel Module, LabVIEW Real-Time Module, LabWindows/CVI Real-Time Module, LabVIEW FPGA Module, LabVIEW Control Design and Simulation Module, Vision Development Module, LabVIEW Statechart Module, LabVIEW DSC Module, or LabVIEW DSP Module); ("Designated Software"), then the applicable component is one (1) copy of such Designated Software. \par G.\tab\ul Academic Licenses.\ulnone\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278 (1.)\tab\ul Student Edition License.\ulnone If the SOFTWARE is a student edition (including SOFTWARE acquired pursuant to a student install option license), you must (i) be a Student or an Instructor; (ii) have acquired a student edition license; (iii) only, if you are a Student, use the SOFTWARE for your personal education purposes and not for any other purpose, including research, professional, commercial, or industrial purposes; and (iv) only, if you are an Instructor, use the SOFTWARE for your preparation for classroom or lab coursework and not for any other purpose, including use in a classroom or lab, research, professional, commercial, or industrial purposes. The SOFTWARE may be installed on up to three computers. However, only you may use or otherwise run the SOFTWARE, and the SOFTWARE may not be run concurrently (i.e., it may only be launched on one computer at a time). In no event may any of the SOFTWARE be installed or used on a network storage device. You hereby understand and agree that your license will automatically expire upon the conclusion or termination of your enrollment in an Academic Institution (or, in the case of student install option licenses, upon the conclusion or termination of your enrollment at the Academic Institution from which you obtained such license) or should you stop being an Instructor unless otherwise expressly specified by NI or its affiliates in writing; upon any such expiration, you must promptly uninstall all copies of the SOFTWARE. As stated in Section 5 below (without limiting the generality thereof), academic licenses, including student edition licenses, may not be transferred.\par (2.)\tab\ul Primary and Secondary School License.\ulnone If you have acquired a primary and secondary school license, you may use the SOFTWARE solely for educational purposes in your primary and secondary school. Primary and secondary schools are defined as levels K\endash 12 and International Standard Classification of Education (ISCED) levels 0\endash 3. You may install the SOFTWARE on no more than the number of your school\u8242?s computers specified by NI in writing in the applicable quote or other offer documents. If any of the number of computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, you may use the SOFTWARE on the portable computer while temporarily away from your institution\rquote s classroom, lab, or other facilities for the same purpose permitted by this Agreement as you normally use the SOFTWARE on the portable computer while in such facilities. The foregoing rights apply to a single school or campus and do not extend to an entire school district. You may distribute Authorized Applications created with the SOFTWARE that is properly installed on computers located within your campus, school, or department as indicated in the applicable quote or other offer documents; provided that (i) you comply with all the terms and conditions in this Agreement regarding distribution of Authorized Applications and (ii) such distribution, and subsequent use of such Authorized Applications, is only to other primary and secondary schools and for educational purposes only. The foregoing are your only distribution rights under a primary and secondary school license. Notwithstanding anything in this Agreement to the contrary, in no event may you distribute any applications (including code such as VIs and executables) created with the SOFTWARE other than as expressly permitted in this Agreement. Any use of the SOFTWARE under a primary and secondary school license by any person who is not a student or teacher at your primary or secondary school or any use for research, commercial, or industrial purposes is expressly prohibited. \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1136 (3.)\tab\ul Academic Teaching License.\ulnone If you have acquired an academic teaching license, you may use the SOFTWARE solely for instructional purposes in your department, college, or on a specific university campus, in each case, of an Academic Institution, depending on the option selected in the applicable purchase order submitted to NI. A use will be considered as one for "instructional purposes" only if such use meets either of the following criteria: (i) a common exam is given to Students at the end of a semester or other academic period and the exam relates (in whole or part) to the Students\u8242? use of the SOFTWARE or (ii) homework or similar projects requiring the use of the SOFTWARE are used for grading in lieu of an exam. You may install the SOFTWARE on no more than the number of your Academic Institution\u8242?s computers (located within the applicable department, college, or specific university campus) specified by NI in writing in the applicable quote or other offer documents. If any of the number of computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, you may use the SOFTWARE on the portable computer while temporarily away from your institution\rquote s classroom, lab, or other facilities for the same purpose permitted by this Agreement as you normally use the SOFTWARE on the portable computer while in such facilities. You may distribute Authorized Applications created with the SOFTWARE, provided, however, that (i) you comply with all the terms and conditions in this Agreement regarding distribution of Authorized Applications and (ii) such distribution, and subsequent use of such Authorized Applications, is for academic purposes only. Except for the foregoing limited distribution right, in no event may you distribute any software deliverables created with the SOFTWARE under an academic teaching license without the prior written approval of NI. Without limiting the generality of the foregoing, any use of the SOFTWARE by any person who is not a Student or Instructor at your Academic Institution or any use for research, commercial, or industrial purposes under this Agreement is prohibited.\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278 (4.)\tab\ul Student Install Option.\ulnone If you are an Academic Institution and have acquired student install option licenses, NI will deliver to you the master installation disks for the applicable Student Edition SOFTWARE. You may make the applicable Student Edition SOFTWARE available only to (i) no more than the number of Students specified by NI in writing in the applicable quote or other offer documents and (ii) Students that are currently enrolled at the applicable department, college, or specific university campus of your Academic Institution specified by NI in writing in the applicable quote or other offer documents. All use of the SOFTWARE under a student install option license shall be in accordance with the student edition license terms and conditions above. The applicable student install option license will automatically expire upon the conclusion or termination of the applicable Student\u8242?s enrollment at your Academic Institution; upon any such expiration, the Student must promptly uninstall all copies of the SOFTWARE. As stated in Section 5 below (without limiting the generality thereof), academic licenses, including Student Install Option licenses, may not be transferred (including to other Students or to another Academic Institution). \par (5.)\tab\ul Academic Research Option.\ulnone If you have acquired an academic research license, you may use the SOFTWARE solely for academic research, teaching, and educational purposes in your department, college, or on a specific university campus, in each case, of an Academic Institution, depending on the option selected in the applicable purchase order submitted to NI. You may install the SOFTWARE on no more than the number of your computers specified by NI in writing in the applicable quote or other offer documents. If any of the number of computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, you may use the SOFTWARE on the portable computer while temporarily away from your institution\rquote s classroom, lab, or other facilities for the same purpose permitted by this Agreement as you normally use the SOFTWARE on the portable computer while in such facilities. You may distribute Authorized Applications created with the SOFTWARE; provided, however, that (i) you comply with all the terms and conditions in this Agreement regarding distribution of Authorized Applications; and (ii) such distribution and subsequent use is for academic purposes only. Except for the foregoing limited distribution right, in no event may you distribute any software deliverables created with the SOFTWARE under an academic research license without the prior written approval of NI. Without limiting the generality of the foregoing, any use of the SOFTWARE for commercial or industrial purposes under this Agreement is prohibited. You must purchase Software Service for the SOFTWARE to maintain the license.\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj H.\tab\ul Evaluation License; Pre-Release Software.\ulnone If you have acquired an evaluation license, you may install and permit your employees to use the SOFTWARE on computers in your workplace for internal evaluation purposes only. If the computers are laptop, notebook or similar portable computers, you may use the SOFTWARE on the portable computers while temporarily away from your workplace for internal evaluation purposes only in the same manner as you would normally do so on the portable computers while in your workplace. You will be deemed to have an evaluation license for all SOFTWARE that has been provided to you by NI and for which you do not have a written document from NI expressly designating the type of license granted to you for the SOFTWARE. The evaluation license is for your own internal use only. Therefore, notwithstanding anything in this Agreement to the contrary, you may not distribute or transfer any applications you create with the SOFTWARE under an evaluation license. You also agree to use reasonable efforts to provide feedback to NI regarding your use of the SOFTWARE, including promptly reporting to NI errors or bugs that you might find. Any such feedback you disclose to NI, including any changes or suggested changes to NI\u8242?s current or future products and services (collectively "Feedback"), shall be received and treated by NI on a non-confidential and unrestricted basis, notwithstanding any restrictive or proprietary legends to the contrary accompanying or otherwise associated with the Feedback. You hereby grant to NI a worldwide, royalty-free, non-exclusive, perpetual, and irrevocable license to use, copy, and modify Feedback for any purpose, including incorporation or implementation of such Feedback into NI products or services, and to display, market, sublicense and distribute Feedback as incorporated or embedded in any product or service distributed or offered by NI. You also acknowledge and agree that the \b SOFTWARE IS EVALUATION ONLY AND/OR PRE-RELEASE SOFTWARE. AS SUCH, THE SOFTWARE MAY NOT BE FULLY FUNCTIONAL AND YOU ASSUME THE ENTIRE RISK AS TO THE RESULTS AND PERFORMANCE OF THE SOFTWARE. NI WILL NOT UPDATE THE SOFTWARE, NOR WILL NI SUPPORT THE SOFTWARE. THE SOFTWARE MAY CONTAIN CODE THAT WILL, AFTER A CERTAIN TIME PERIOD, DEACTIVATE THE SOFTWARE AND RENDER THE SOFTWARE UNUSABLE. ALTHOUGH THE SOFTWARE MAY WARN YOU OF THE TIME-FRAME IN WHICH IT WILL BE DISABLED, YOU ACKNOWLEDGE AND AGREE THAT THE SOFTWARE MAY BE DEACTIVATED OR RENDERED UNUSABLE WITH OR WITHOUT WARNING.\b0 Upon such deactivation, this Agreement will be considered terminated. Prior to deactivation of the SOFTWARE, you may contact NI to convert your evaluation license for the SOFTWARE to a named user license or computer based license, under such terms, and to the extent, if any, that NI generally makes such licenses available for the SOFTWARE, or such other license as NI may (in its sole discretion) permit by paying to NI the applicable license fee and obtaining from NI the applicable authorization code(s). NI may (in its sole discretion and upon notice to you) terminate the evaluation license at any time, whereupon this Agreement will be considered terminated. If the SOFTWARE consists of pre-release SOFTWARE and is also covered by an alpha/beta license (the "Beta Agreement") between you and NI, the terms and conditions of the Beta Agreement, which are incorporated herein by reference, shall also apply to your use of the SOFTWARE. In the event of a conflict between this Agreement and the Beta Agreement, the terms of the Beta Agreement shall control.\par I.\tab\ul VLP Notes.\ulnone The following applies to the VLP (Volume License Program): \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278 (1.)\tab\ul Program Requirements.\ulnone You shall designate a separate Software Administrator for each Site and shall promptly notify NI in writing of any changes to the Software Administrator(s). In order to participate in the VLP, the VLP Licenses that you maintain during the VLP Term must at all times include a minimum of five (5) copies (in the aggregate) of a version of the SOFTWARE which is considered by NI to be a development version of a single NI SOFTWARE product. NI will deliver the master installation disks for the SOFTWARE and, if provided for in the applicable written quotation from NI, make available the NI VLM to the Software Administrator(s). You are responsible for ensuring that an Approved Volume License Manager, together with the most current license file provided by NI that controls end-user access to the SOFTWARE, (to the extent NI has made the SOFTWARE compatible with an Approved Volume License Manager) is in use at all times with the SOFTWARE licensed under the VLP (during the term of the VLP and thereafter). If the Approved Volume License Manager is the NI VLM or if NI makes documentation available for the applicable Approved Volume License Manager, such Approved Volume License Manager shall be installed and used in accordance with the documentation provided by NI. If you have existing individual, computer based or named user licenses for the SOFTWARE that are to be covered by the VLP, (i) you shall notify NI in writing of the product, platform, and serial number information for each such license; (ii) each such license shall (as of the VLP Effective Date) no longer be in effect and shall be superseded by the VLP; (iii) all individual serial numbers for each such license shall be cancelled and replaced by a single, common serial number assigned to the VLP and the corresponding VLP Licenses; and (iv) should you later desire to obtain individual serial numbers for any of the VLP Licenses, you will be required to pay NI its then current fee for a conversion from a VLP License to an individual named user license, computer based license, debug license or Measurement Studio compile-only license having an individual serial number. Regarding Software Service, NI reserves the right to restrict Software Service to the then most current version of the SOFTWARE that is commercially available. You understand that NI may not make available Software Service for all SOFTWARE available under the VLP. \par (2.)\tab\ul Activity Compliance Logs.\ulnone In addition to the submission requirement in sub-section (4.) below, you are required to provide an Activity Compliance Log for each Site to NI promptly (but in no event later than fifteen (15) days) following (i) the annual anniversary of the VLP Effective Date during the VLP Term and (ii) the VLP Termination Date. NI may, upon notice to you, inspect the Site(s) and applicable records in order to verify the accuracy of the Activity Compliance Logs. You shall pay any verified underpayments to NI within thirty (30) days of receipt of a written notice of such underpayments. Further, if you have underpaid, NI may require you to pay for any reasonable out-of-pocket costs actually incurred by NI in verifying the underpayment. \par (3.)\tab\ul Purchase Orders; Invoices.\ulnone You shall submit purchase orders to NI as follows: \b\par \pard\nowidctlpar\fi-360\li1440\sb100\sa240\qj\tx1846\b0 a.\tab in the amount of the Activation Fee within the time-frame specified in the quote provided by NI to you for the VLP; \par b.\tab in the amount of the Additional VLP Fees prior to the end of the then current VLP Term as set forth below; and \par c.\tab in the amount of the VLP Renewal Fees prior to the end of the then current VLP Term as set forth below if you desire to renew the VLP. \par \pard\nowidctlpar\li1080\sb100\sa240\qj You are required to obtain and maintain Software Services for each VLP License for which Software Services are made available by NI. The Software Services are charged on an annual basis and, for VLP Licenses added during the VLP Term, will only be pro-rated on a quarterly basis (based on the quarter of the VLP Term in which the SOFTWARE under such VLP License was first used), or such shorter basis as NI may designate, if a purchase order is submitted to NI prior to the date the SOFTWARE for the Additional VLP License is installed or otherwise used. All invoices shall be paid within thirty (30) days of the date you receive them.\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278 (4.)\tab\ul VLP Term.\ulnone The initial term of the VLP will start on the VLP Effective Date and continue for a period of one (1) year (the "Initial VLP Term"). You may renew the VLP for additional one (1) year periods (the Initial VLP Term and each such renewal term, each herein referred to herein as a "VLP Term"). Should you desire to renew the VLP for an additional one (1) year period, you must provide a current Activity Compliance Log to NI at least sixty (60) days before the end of the then current VLP Term so that the number of VLP Licenses for the SOFTWARE may be determined. NI will then provide you with a quote for Software Services, any Additional VLP Fees that are applicable, and any new VLP Licenses that you request for the renewal VLP Term (the "VLP Renewal Fee"). The VLP will be renewed for an additional one (1) year period each time you issue to NI a purchase order for the VLP Renewal Fees prior to the end of the then current VLP Term. You shall promptly notify NI if the information in the Activity Compliance Log regarding the number of VLP Licenses changes following your submission, and NI reserves the right to revise the VLP Renewal Fee (as applicable) to reflect Additional VLP Licenses used and not reflected in the applicable Activity Compliance Log that you provided to NI at the time you desired to renew. \b IF, PRIOR TO THE END OF THE THEN CURRENT VLP TERM, YOU DO NOT ISSUE A PURCHASE ORDER FOR THE SOFTWARE SERVICES AND ANY ADDITIONAL VLP FEES THAT ARE DUE (I) THE VLP WILL AUTOMATICALLY TERMINATE AT THE END OF THE CURRENT VLP TERM; (II) ALL SOFTWARE SERVICES FOR THE VLP WILL AUTOMATICALLY AND IMMEDIATELY TERMINATE AT THE END OF THE THEN CURRENT VLP TERM; AND (III) YOU MAY NOT, IN ANY EVENT, EXCEED THE NUMBER OF VLP LICENSES FOR WHICH YOU HAVE PAID THE REQUIRED FEES TO NI. UPON TERMINATION OF THE VLP, NI WILL ATTEMPT TO PROVIDE YOU WITH AN UPDATED LICENSE FILE AND YOU MAY CONTINUE TO USE THE VLP LICENSES IN EFFECT (AND FOR WHICH YOU HAVE PAID THE REQUIRED FEES TO NI) PRIOR TO THE DATE OF TERMINATION (THE "SURVIVING VLP LICENSES"); PROVIDED THAT ALL SUCH USE IS CONDUCTED WITH AN APPROVED VOLUME LICENSE MANAGER (USING THE LICENSE FILE PROVIDED BY NI FOLLOWING THE TERMINATION OF THE VLP) AND IS CONDUCTED PURSUANT TO THE TERMS AND CONDITIONS OF THIS AGREEMENT (INCLUDING THE PROHIBITIONS ON TRANSFER AS SET FORTH IN SECTION 5 BELOW). IN NO EVENT MAY YOU INCREASE THE NUMBER OF THE SURVIVING VLP LICENSES FOLLOWING THE TERMINATION OF THE VLP. IT IS YOUR RESPONSIBILITY TO OBTAIN SUCH LICENSE FILE FROM NI AND TO INSTALL AND USE THE LICENSE FILE AS SOON AS POSSIBLE AFTER DELIVERY OF SUCH LICENSE FILE FROM NI, BUT IN NO EVENT LATER THAN SIXTY (60) DAYS AFTER THE TERMINATION OF THE VLP. THE SOFTWARE AND THE APPROVED VOLUME LICENSE MANAGERS MAY CONTAIN CODE THAT WILL, FOLLOWING TERMINATION OF THE VLP, DEACTIVATE YOUR ABILITY TO USE THE SOFTWARE UNDER THE VLP. ALTHOUGH THE NI VLM MIGHT ATTEMPT TO WARN YOU OF THE TIME-FRAME IN WHICH YOUR ABILITY TO ACCESS AND USE THE SOFTWARE WILL BE DISABLED, YOU ACKNOWLEDGE AND AGREE THAT THE SOFTWARE MAY BE AUTOMATICALLY DEACTIVATED OR RENDERED UNUSABLE WITH OR WITHOUT WARNING UPON THE TERMINATION OF THE VLP. ANY REACTIVATION OF THE VLP FOLLOWING ITS TERMINATION SHALL BE AT THE SOLE DISCRETION OF NI AND MAY BE SUBJECT TO THE PAYMENT OF APPLICABLE REACTIVATION FEES AS DETERMINED BY NI. SHOULD YOU AT ANY TIME DESIRE TO OBTAIN INDIVIDUAL SERIAL NUMBERS FOR ANY OF THE VLP LICENSES OR SURVIVING VLP LICENSES, YOU WILL BE REQUIRED TO PAY NI ITS THEN CURRENT FEE FOR A CONVERSION FROM A VLP LICENSE OR A VLP SURVIVING LICENSE (AS APPLICABLE) TO (AS APPLICABLE) AN INDIVIDUAL NAMED USER LICENSE, COMPUTER BASED LICENSE, DEBUG LICENSE OR MEASUREMENT STUDIO COMPILE-ONLY LICENSE HAVING AN INDIVIDUAL SERIAL NUMBER. SHOULD YOU LATER DESIRE TO OBTAIN UPGRADES FOR THE SOFTWARE OR PURCHASE AVAILABLE SOFTWARE SERVICES FOR THE SOFTWARE, YOU WILL BE REQUIRED TO PAY NI AN APPLICABLE FEE FOR EACH SUCH SURVIVING VLP LICENSE.\par \b0 (5.)\tab\ul Additional Definitions.\ulnone For purposes of the VLP, the following capitalized terms have the following meanings: \par \pard\nowidctlpar\li1080\sb100\sa240\qj "Activation Fee" means the amount specified in the applicable written quotation from NI that permits you to replace the existing individual named user, computer based, debug or Measurement Studio compile-only licenses for the SOFTWARE used at the Site that you designate with a VLP License and/or acquire a VLP License at the Site for the number of named user, computer based, debug or Measurement Studio compile-only licenses listed in the written quotation from NI. The Activation Fee consists of a one-time license fee for each VLP License in effect at the start of the VLP Effective Date and an initial annual user fee for Software Services. Documentation is provided in electronic form only and comes with the master installation disk for the SOFTWARE. You may, however, purchase from NI sets of applicable written documentation and additional master installation disks at NI\u8242?s then prevailing rates.\par "Additional VLP Fees" means the fees (i.e., one-time license and initial annual fees for Software Services) for each Additional VLP License installed (i.e., in use) during the applicable VLP Term beyond the number of initial VLP Licenses.\par "Additional VLP License" means each computer based license, named user license, debug license, or Measurement Studio compile-only license you add, in accordance with the terms and conditions set forth herein, during the applicable VLP Term. \par "Site(s)" is/are the physical location to which NI delivers the SOFTWARE unless otherwise specified in the VLP Documentation. \par "Surviving VLP License" has the meaning set forth in Section 2.I.(4.) above.\par "VLP Documentation" means the quote(s) that you obtain from NI regarding the VLP and the VLP Welcome Kit you obtain from NI. \par "VLP Effective Date" means the date that the VLP Welcome Kit is sent to you; provided, however, that if the VLP is terminated and then reactivated, as permitted in Section 2.I.(4.) above, then the VLP Effective Date means the date the VLP is reactivated by NI. \par "VLP License" means each individual named user license, computer based license, concurrent use license, debug license and/or Measurement Studio compile-only license to the SOFTWARE used by you under the VLP during the term of the VLP. \par "VLP Renewal Fees" has the meaning set forth in Section 2.I.(4.) above.\par "VLP Term" has the meaning set forth in Section 2.I.(4.) above.\par "VLP Termination Date" means the date that the VLP terminates in accordance with the provisions above. \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj J.\tab\ul EP Notes.\ulnone The following applies to the EP (Enterprise Program): \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278\cf2 (1.)\tab\ul EP Services.\ulnone The specific services that NI will provide to you under the EP are designated in the EP Documentation, and may include Software Services and Training & Certification Services as described below. With respect to the specific services listed below, the following shall apply:\par \pard\nowidctlpar\fi-360\li1440\sb100\sa240\qj a.\tab\ul Training & Certification Services.\ulnone If the services to be provided under your EP include Training & Certification Services, you may use available Training Credits during the EP Term as you desire for your employees to attend applicable training classes regarding the use of the SOFTWARE and/or to receive applicable "certification preparation" courses and certification testing services from NI. Available training classes may, unless otherwise noted, be attended on-line, attended at the corporate training facilities of NI, or may be conducted on-site at the Training Location(s) identified in your EP Documentation. Unless expressly agreed to in writing by NI, however, training classes may not be attended under the EP at training centers operated by third parties, even if such third parties are approved by NI to provide training. Although NI may provide a training schedule which lists applicable training classes that are available as of the EP Effective Date, the training schedule is subject to change at any time without notice to reflect changes in available dates and to include new classes or to remove or modify previously listed classes; provided, however, that the number of Training Credits required to attend an available course shall not change during the EP Term. Attendance at on-line training classes is subject to availability of applicable on-line seats. Training classes to be conducted at the Training Location(s) or at the corporate training facilities of NI are subject to availability of instructors and must be scheduled at least thirty (30) days in advance. There shall be no charge to you for applicable travel, lodging, and meal expenses associated with NI instructors providing on-site training services under the EP at the Training Location(s); provided, however, that, should you cancel a scheduled on-site training class, NI may invoice you for the actual cost of any non-refundable travel-related expenses that NI must incur with respect to such cancellation. Training Credits have no cash value and any unused Training Credits shall expire upon termination or expiration of your EP Term. \par b.\tab\ul Software Service.\ulnone You shall designate a Software Administrator and shall promptly notify NI in writing of any changes to the Software Administrator. If the services to be provided under the EP include Software Services, then, instead of any obligation with respect to the delivery of copies of Upgrades under a VLP, NI shall provide: (i) your Software Administrator a master copy of all Upgrades after the applicable commercial release date and (ii) the number of your users designated in the EP Documentation with access to NI\u8242?s application engineers for issues involving the installation and use of the SOFTWARE ("Phone Support"), and with access to NI\rquote s customer on-line technical support system ("Web Support"), all in accordance with NI\rquote s then current standard software maintenance and support policies. If the Support Services to be provided under the EP include Premier Software Support Services, NI shall provide access to the Premier Software Support Services to the number of your employees designated in the EP Documentation. NI reserves the right to restrict Software Service to the then most current version of the SOFTWARE that is commercially available. You understand that NI may not make available Software Service for all SOFTWARE available under the EP.\par \cf0 c.\tab\ul No Hardware or Hardware Services.\ulnone You acknowledge and agree that no hardware or hardware-related services are being provided or otherwise made available by NI under the EP or this Agreement. \ul\b\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278\ulnone\b0 (2.)\tab\ul Annual Management Review; Reports.\ulnone \ul\par \pard\nowidctlpar\fi-360\li1440\sb100\sa240\qj\ulnone a.\tab Upon such periodic basis as set forth in the EP Documentation (but at least annually), your representatives shall meet with NI\rquote s representatives to discuss the EP and your use of the EP, including, but not limited to, evaluating usage of the NI Software and Training Credits under the EP and determining the adequacy of licensing levels and number of EP Location(s) under the EP.\par \cf2 b.\tab You are responsible for ensuring that an Approved Volume License Manager, together with the most current license file provided by NI that controls end-user access to the SOFTWARE, (to the extent NI has made the SOFTWARE compatible with an Approved Volume License Manager) is in use at all times with the SOFTWARE licensed pursuant to the EP (during the EP Term and thereafter). If the Approved Volume License Manager is the NI VLM or if NI makes documentation available for the applicable Approved Volume License Manager, such Approved Volume License Manager shall be installed and used in accordance with the documentation provided by NI. Thirty (30) days prior to the meeting referenced in sub-section (2.) a. above or upon such other reasonable basis as NI may request, you shall provide NI with: (a) Activity Compliance Logs for each of the EP Locations and (b) a Usage Log for the SOFTWARE at the EP Location(s) with such Usage Log being generated by the applicable Approved Volume License Manager. NI may, upon notice to you, inspect the Site(s) and applicable records in order to verify the accuracy of the Activity Compliance Logs and the Usage Logs. \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1420\cf0 (3.)\tab\ul EP Term.\ulnone \par \pard\nowidctlpar\fi-360\li1440\sb100\sa240\qj a.\tab The "EP Term" shall have the meaning set forth below. Either NI or you may (in its discretion) terminate the EP Term upon written notice to the other party, if such other party is in material breach of any of its obligations under Section 2.C. or this 2.J., and has not cured such breach to the reasonable satisfaction of the non-breaching party within thirty (30) days of receiving written notice of such material breach from the non-breaching party. Further, should this Agreement, or any of the licenses granted by NI under this Agreement, terminate because of your failure to comply with any of the other terms of this Agreement, NI may terminate the EP Term upon providing you with written notice of such termination. Unless mutually agreed to in writing by you and NI, the EP Term shall not renew following the expiration of the EP Term.\par b.\tab Effect of EP Term Expiration or Termination. Upon expiration or termination of the EP Term: \par \pard\nowidctlpar\fi-360\li1800\sb100\sa240\qj\tx1846 (i) \tab all use of the SOFTWARE under the EP shall immediately stop and you must destroy all copies of the SOFTWARE, provided however that you must deliver the SOFTWARE and all copies to NI if NI has so demanded prior to such destruction; provided, however, that\par \pard\nowidctlpar\fi-360\li2160\sb100\sa240\qj (1)\tab with respect to the EP Pre-Existing SOFTWARE, unless the EP Term is terminated by NI based on other than an EP-Only Breach, you may continue to use copies of such EP Pre-Existing SOFTWARE as may be designated in the EP Documentation for post-EP Term use, but any such post-EP Term use is permitted solely at the EP Locations and pursuant to, and solely in accordance with, the terms and conditions set forth in this Agreement regarding the specific type of license designated for such EP Pre-Existing SOFTWARE in the EP Documentation, applicable to such license type acquired under the VLP, and \par (2)\tab with respect to any copies of the EP Pre-Existing Software which are designated in the EP Documentation for post-EP Term use which were either the most current version or the immediately prior version of the SOFTWARE as of the EP Effective Date, provided that the EP Term was not terminated by NI, you may elect to upgrade such copies to the current version of the applicable SOFTWARE as of the effective date of termination or expiration of the EP Term for use by you solely in accordance with sub-section (3.)b.(i)(1) above,\par \pard\nowidctlpar\li2160\sb100\sa240\qj but any and all rights under sub-sections (3.)b.(i)(1) and (2) above shall not apply to copies of any SOFTWARE the license for which terminated during, or upon termination of, the EP Term as a result of your failure to comply with the terms of this Agreement, it being understood that any and all rights of you to use such copies would have terminated upon such termination of such license; \par \pard\nowidctlpar\fi-360\li1800\sb100\sa240\qj\tx1846 (ii) \tab you shall provide NI with the Activity Compliance Logs and Usage Logs referenced within thirty (30) days of the effective date of such expiration or termination of the EP Term; and \par (iii)\tab you shall immediately pay to NI all amounts not paid as of the effective date of expiration or termination of the EP Term.\par \pard\nowidctlpar\li360\sb100\sa240\qj\b IT IS YOUR RESPONSIBILITY TO OBTAIN ANY NECESSARY LICENSE FILES FROM NI TO ENABLE ANY PERMITTED POST-EP TERM USE OF ANY COPIES OF EP PRE-EXISTING SOFTWARE WHICH ARE DESIGNATED IN THE EP DOCUMENTATION FOR POST-EP TERM USE, AND TO INSTALL AND USE THE LICENSE FILE AS SOON AS POSSIBLE AFTER DELIVERY OF SUCH LICENSE FILE FROM NI, BUT IN NO EVENT LATER THAN SIXTY (60) DAYS AFTER THE TERMINATION OF THE EP TERM. THE SOFTWARE AND THE APPROVED VOLUME LICENSE MANAGERS MAY CONTAIN CODE THAT WILL, FOLLOWING TERMINATION OF THE EP TERM, DEACTIVATE YOUR ABILITY TO USE THE SOFTWARE UNDER THE EP. ALTHOUGH THE NI VLM MIGHT ATTEMPT TO WARN YOU OF THE TIME-FRAME IN WHICH YOUR ABILITY TO ACCESS AND USE THE SOFTWARE WILL BE DISABLED, YOU ACKNOWLEDGE AND AGREE THAT THE SOFTWARE MAY BE AUTOMATICALLY DEACTIVATED OR RENDERED UNUSABLE WITH OR WITHOUT WARNING UPON THE TERMINATION OF THE EP. \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278\b0 (4.)\tab\ul EP Fees.\ulnone\b \b0 The fees that will be charged to you in connection with the EP are set forth in the EP Documentation. Unless specified otherwise in the EP Documentation, all annual amounts due for the EP shall be paid by you to NI, or to the NI affiliate entering into the EP Documentation with you, within thirty (30) days of the date of each applicable invoice. All sums not paid when due shall accrue interest at the lesser of a monthly rate of 1.5% or the highest rate permissible by law on the unpaid balance until paid in full. Unless set forth otherwise in the EP Documentation, all amounts to be paid by you under the EP shall be in U.S. dollars. All fees quoted do not include applicable taxes or import/export duties. All sales, use, transient occupancy, and excise taxes and all import, export, or other duties relating to any deliverables provided by NI under the EP shall be your responsibility and be borne by you. All foreign, federal, state, and local taxes, however, based upon or measured by NI\u8242?s net income, property, or net worth shall be the responsibility of and be borne by NI. If you directly or indirectly acquire a company or business that that has 20 or more current NI software licenses, then the fees that may be charged to you in connection with the EP will be increased. \b\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1420\b0 (5.)\tab\ul Confidentiality.\ulnone The terms of your EP Documentation, and any proposals or other documents submitted by NI, or an authorized NI affiliate, (including all pricing and fees) in connection with your EP, and any information about NI product development efforts provided in connection with your EP, shall be considered the confidential information of NI and you shall not disclose such information to any third party.\par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1278 (6.)\tab\ul Additional Definitions.\ulnone For purposes of the EP, the following capitalized terms have the following meanings\par \pard\nowidctlpar\li1080\sb100\sa240\qj "EP Documentation" means the NI Enterprise Program Documentation entered into between NI, or an authorized NI affiliate, and you as described in Section 2.C. \par "EP Effective Date" means the Effective Date identified in the EP Documentation. If there is no Effective Date so identified, the EP Effective Date is the date that the EP Documentation signed by NI is sent to you. \par "EP Locations" means your facility or facilities identified as Location(s) in your EP Documentation. \par "EP-Only Breach" means your material breach of any of your obligations under Section 2.C. or this Section 2.J. where your material breach is only a failure to comply with a term of Section 2.C. or this Section 2.J., and is not based on, and does not also amount to, a failure to comply with any other term of this Agreement.\par "EP Pre-Existing Software" means the licenses from NI to you for the SOFTWARE covered by the EP which were in effect immediately before the Effective Date and which are identified as Pre-Existing NI Software in the EP Documentation. \par "EP Term" means the period of time beginning on the EP Effective Date and ending upon the expiration of the number of years thereafter stated in the EP Documentation. If no such number of years is stated in the EP Documentation, the number of years shall be three (3). The EP Term is subject to earlier termination as set forth above. \par "Training & Certification Services" means the provision by NI, as applicable, of: (i) software training classes and (ii) \ldblquote certification preparation\rdblquote courses and certification testing services for software of NI, in accordance with NI\u8242?s then current standard policies for software training and certification.\par "Training Credits" means the number of credits listed in the EP Documentation for obtaining Training & Certification Services.\par "Training Location(s)" means those Location(s) which have been identified in the EP Documentation as Location(s) at which on-site training may be provided. If no such Location(s) are designated, then Training Location(s) shall be those Location(s) which are mutually agreed to in writing by the parties as also being Training Location(s). \par "Usage Log" means a comprehensive log of every check-out and check-in operation done by the license server.\cf2\b \cf0\b0\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj K.\tab\ul Driver Interface Software.\ulnone If the SOFTWARE is or contains Driver Interface Software you may use the Driver Interface Software for your internal development of Authorized Applications, and, if you are a business or other entity, you may make and install a reasonable number of copies of the Driver Interface Software, other than NI-VISA or NI-488.2, as may be reasonably required for your internal development of Authorized Applications. You may not make additional copies of NI-VISA and NI-488.2 except as expressly permitted in clause (i) of Section 10 or by NI in writing. If you received the Driver Interface Software from a third party with or as part of an Authorized Application then you may only use the Driver Interface Software with such Authorized Application. \par L.\tab\ul Measurement Studio Compile-Only License.\ulnone If you have acquired a Measurement Studio compile-only license, you must have also licensed Measurement Studio under a separate named user license, computer based license, or VLP License with NI, in which case your applicable employee(s) may now, under the Measurement Studio compile-only license, install the Measurement Studio SOFTWARE on the number of computers in your workplace identified in the applicable documentation provided to you by NI. There is no limitation on the number of your employees that may access and use the Measurement Studio SOFTWARE on such computer(s). If any of such computers on which the SOFTWARE may be installed is a laptop, notebook or similar portable computer, you may use the SOFTWARE as permitted by this Section 2.L on the portable computer while temporarily away from your workplace. The Measurement Studio SOFTWARE may be installed or used on a network storage device and the Measurement Studio SOFTWARE may be run concurrently; provided however that only your applicable employee(s) may access or use the Measurement Studio SOFTWARE on the network storage device. You may only use the compile/build function of the Measurement Studio SOFTWARE and you may only perform that function on source code (for your Authorized Application) that references the Measurement Studio libraries and was developed by you with a license for Measurement Studio SOFTWARE that permits the development of such source code (e.g. not a Measurement Studio compile-only license). In no event may you use the Measurement Studio compile\_only license to develop source code that references the Measurement Studio libraries (including writing code that creates a new instance of a class defined in a Measurement Studio library or that calls a static method of a class defined in the Measurement Studio library).\par M.\tab\ul Third Party Contractors.\ulnone If you have acquired one of the licenses set forth in Section 2.A., B., C., D., E., F., H., or K. above, then third party contractors that you have engaged may (if you desire) access and use the SOFTWARE solely for your benefit; provided: (i) the contractor (or, if applicable, its employee) shall be considered, as applicable, the Named User or Authorized User for purposes of the applicable license type, and all use by such contractor shall be in accordance with the terms and conditions of this Agreement, (ii) before accessing the SOFTWARE, the contractor agrees in writing that (a) the SOFTWARE shall be used solely in accordance with the terms of this Agreement and solely for your benefit and (b) the contractor shall be liable to NI for any breach by it of this Agreement, (iii) you hereby agree and acknowledge that you will be liable for any and all actions or omissions of the contractor with respect to the use of the SOFTWARE, as if such actions or omissions were your own, and (iv) in the case of licenses under Section 2.C., the contractor uses the SOFTWARE only at an EP Location.\par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 3.\tab\ul License Term.\ulnone This Agreement shall continue until the earlier of (i) any termination as provided in this Agreement, or (ii) the expiration of the Agreement as set forth below.\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj A.\tab\ul Term Licenses.\ulnone You hereby acknowledge and agree that this Agreement will expire automatically at the end of the Term. However, if you have not acquired a perpetual license, subject to NI\rquote s acceptance, you may continue the Term for an additional period by remitting the then-current applicable license fee to NI. You hereby acknowledge and agree that the SOFTWARE may stop working and become unusable unless you pay the license fee and, if applicable, are provided with new authorization codes. Any use of the SOFTWARE after the Term expires will violate the terms of this Agreement. If you have purchased Software Service, you understand and agree that the support for the SOFTWARE will only continue for the amount of time specified in your purchase order for Software Service. After such time, you may continue to purchase Software Service at NI\u8242?s then current price, provided that Software Service is offered.\par B.\tab\ul Perpetual Licenses.\ulnone Pursuant to a perpetual license, you have the right to use the SOFTWARE indefinitely, subject to the termination provisions in this Agreement. If you have purchased Software Service, you understand and agree that the support for the SOFTWARE will only continue for the amount of time specified in your purchase order for Software Service. After such time, you may continue to purchase Software Service at NI\u8242?s then current price, provided that Software Service is offered.\par C.\tab\ul Termination.\ulnone This Agreement shall automatically terminate upon failure by you to comply with its terms, except that, if applicable, in the case where your failure to comply is an EP-Only Breach, this Agreement shall not terminate as to the EP Pre-Existing SOFTWARE described in sub-section 2.J.(3.)b.(i) by reason of such EP-Only Breach. \par D.\tab \ul Effect of Termination or Expiration.\ulnone Upon termination or expiration of this Agreement, regardless of the reason, the license grants contained herein shall terminate and you must immediately cease all use of the SOFTWARE and all distribution of Authorized Applications, and immediately destroy all copies of the SOFTWARE, provided however that you must deliver the SOFTWARE and all copies to NI if NI has so demanded prior to such destruction. Sections 14, 15, 17, 18, 19, 20, and 21, sub-section 12.A.(3.), and the Feedback license to NI under Section 2.H., of this Agreement, shall survive any expiration or termination of this Agreement.\par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 4.\tab\ul Restrictions.\ulnone You may not: (i) reverse engineer, decompile, or disassemble the SOFTWARE (except to the extent such foregoing restriction is expressly prohibited by applicable law); (ii) use the SOFTWARE to gain access to unencrypted data in a manner that defeats the digital content protection provided in the SOFTWARE; (iii) sub-license, lease, lend, or rent the SOFTWARE; (iv) (other than as expressly permitted under this Agreement) disclose in whole or in part, distribute in whole or part, modify, or create derivatives of the SOFTWARE or distribute or publish applications created with the SOFTWARE; (v) use the Scripting functionality to create applications which perform the functionality of an editor for a graphical programming environment; (vi) use any H.264/MPEG-4 AVC and/or VC-1 technology or codecs included in or with Microsoft Silverlight software which may be provided by NI as Third Party Software, including for the purpose of encoding or decoding video in compliance with, or making use of, the H.264/AVC visual standard or the VC-1 video standard; (vii) take any action that results in any of the SOFTWARE being subject to an Excluded License; or (viii) directly or indirectly, export, re-export, download, transmit, or ship the SOFTWARE in violation of Section 21.D. or otherwise in violation of any applicable laws or regulations, including those of the U.S., the European Union or the jurisdiction in which you use or are downloading the SOFTWARE. Further, all uses of the SOFTWARE shall be in accordance with the applicable documentation that accompanies the SOFTWARE and not in any manner intended to (or that) circumvents such documentation or the intent of this Agreement. Except as expressly permitted in Section 2, under no circumstance is "floating," shared, or concurrent use permitted under this Agreement. Further, if you have acquired a computer based NI TestStand Development System License or NI TestStand Custom Sequence Editor License, you may not remotely access the SOFTWARE. If you have acquired a named user NI TestStand Development System License or NI TestStand Custom Sequence Editor License, only the then current Named User may remotely access the SOFTWARE. \par \pard\nowidctlpar\li360\sb100\sa240\qj Additionally, the use of the SOFTWARE is intended only for use with content owned by the user, public domain content or properly licensed content. You may require a patent, copyright, or other license from a third party to create, copy, download, record or save content files for use with this SOFTWARE or to serve or distribute such files to be used with the SOFTWARE. You agree that you shall only use the SOFTWARE and documentation in a manner that complies with all applicable laws in the jurisdictions in which you use the SOFTWARE and documentation, including applicable restrictions concerning copyright and other intellectual property rights. You may not use the SOFTWARE in an attempt to, or in conjunction with, any device, program or service designed to, circumvent technological measures employed to control access to, or the rights in, a content file or other work protected by the copyright laws of any jurisdiction. \par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426\tx4860 5.\tab\ul Transfer.\ulnone If you have a named user license, computer based license, debug license, or if the SOFTWARE is Multiple Access Software, you may transfer the SOFTWARE to a third party in the same country in which you purchased the SOFTWARE or within the European Union if you purchased the SOFTWARE in the European Union provided that you notify NI in writing of such transfer (including the name and location of such third party), such third party accepts the terms and conditions of this Agreement, and after such transfer, you do not retain any copies of the SOFTWARE (including all Upgrades that you may have received) nor retain any of the written materials accompanying the SOFTWARE. NI may, in its discretion, charge you a fee for the transfer of the SOFTWARE. If you have a VLP License, a Surviving VLP License, a concurrent use license, an academic license (including a student edition license), a Measurement Studio compile-only, or a debug license, the license is non-transferable and you may not, without the prior written consent of NI or its affiliates, distribute or otherwise provide the SOFTWARE to any third party or (with respect to a VLP License or a Surviving VLP License) to any of your sites or facilities not expressly identified in the applicable documents from NI. If you have any licenses under the EP, such licenses are non-transferable and you may not, without the prior written consent of NI or an authorized NI Affiliate distribute or otherwise provide the SOFTWARE to any third party or to any of your sites or facilities other than an EP Location.\par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 6.\tab\ul Upgrades; Additional Licenses for Prior Versions.\ulnone If the SOFTWARE is an Upgrade, you may only use the SOFTWARE if: (i) you have (at the time you receive the Upgrade) a valid license to use the pre-existing SOFTWARE (the "Pre-existing License") and (ii) the Upgrade was provided to you in accordance with the Limited Warranty noted below in Section 13 or provided to you as part of the Software Service for which you have paid applicable fees. The license agreement accompanying the Upgrade (the "Upgrade License") applies to your use of the Upgrade; provided, however, (i) you may only install and use the Upgrade on those computers on which you are authorized to use the pre-existing SOFTWARE pursuant to the Pre-existing License and (ii) in no event may you run both the Upgrade and the pre-existing SOFTWARE concurrently. Further and with respect to any SOFTWARE delivered and licensed under this Agreement ("Delivered SOFTWARE"), you may elect to install and use a pre-existing version of the applicable SOFTWARE (rather than the Delivered SOFTWARE); provided, (i) you have an authorized copy of the pre-existing version of the Delivered SOFTWARE, (ii) all use will be pursuant to and in accordance with this Agreement (including the license type acquired for the Delivered SOFTWARE), and (iii) that notwithstanding anything in this Agreement to the contrary, in no event shall NI be required to support any versions of the SOFTWARE (including providing applicable software key codes or hardware keys) other than the then most current version of the Delivered SOFTWARE.\par 7.\tab\ul Home Usage Exception.\ulnone Notwithstanding anything in this Agreement to the contrary, if you are a business or other entity, the designated Named User for the applicable license (or in the case of computer based licenses, the single individual who is the primary user of the single computer on which the SOFTWARE is installed and used, or in the case of Academic Licenses the teachers, professors or researchers) may also install and use the SOFTWARE on one (1) computer located in such user\u8242?s home, provided that (i) the use of the SOFTWARE is pursuant to one of the licenses enumerated in Section 2 above (other than a Designated Deployment License, Measurement Studio compile-only license, debug license, concurrent use license, or concurrent use debug license); and (ii) the use of the SOFTWARE on such home computer is limited to work performed in the scope of such person\u8242?s employment with you (or, in case of an Academic License, limited to the uses expressly permitted in such applicable section) and complies with all terms and conditions of this Agreement other than as expressly set forth in this Section. The SOFTWARE must be promptly uninstalled from the individual\rquote s home computer upon the earlier of (a) the termination of the designated individual\rquote s employment with you, (b) the transfer of the SOFTWARE to another Named User or change to another computer as permitted under Section 2 above, (c) the termination or expiration of this Agreement, or (d), in the case of Academic Licenses, the teacher, professor or researcher ceasing to be employed by the Academic Institution (whichever is earlier). Notwithstanding the foregoing, if you have a Designated Deployment License, Measurement Studio compile-only license, debug license, concurrent use license, or concurrent use debug license, this Home Usage Exception does not apply to you. \par 8.\tab\ul Multiple Versions (CD-ROM/DVD-ROM Media).\ulnone If the SOFTWARE is distributed on a CD-ROM or DVD-ROM containing multiple versions of the SOFTWARE for use with different operating systems, you may only use one version of the SOFTWARE. The foregoing limitation does not apply to Multiple Access Software. \par 9.\tab\ul Software/Hardware Key.\ulnone If the SOFTWARE requires a software key code or a hardware key, you acknowledge that the SOFTWARE will not function without a certain, unique software key code or hardware key. This software key code or hardware key will be furnished to you by NI and you agree that such software key code and hardware key is to be used solely with the SOFTWARE for which it is provided. While NI may (in its sole discretion) provide you with the applicable key prior to receipt from you of the applicable license fees, you will remain obligated to pay such fees to NI. \par 10.\tab\ul Copyright; No Other Licenses.\ulnone The SOFTWARE, and all copies of the SOFTWARE, are owned by NI or its suppliers and are protected by applicable copyright laws and international treaty provisions. The SOFTWARE, and copies thereof, are licensed only, and are not sold or leased. Therefore, you must treat the SOFTWARE like any other copyrighted material. You may, however, (i) make a reasonable number of copies of the SOFTWARE solely for backup or archival purposes and (ii) make a reasonable number of copies of the documentation that accompanies the SOFTWARE solely for your internal use in connection with your use of the SOFTWARE. In no event may you remove or alter any copyright, patent, trademark, or other legal notices or disclaimers that exist in the SOFTWARE. All rights not expressly granted to you in this Agreement are reserved to NI. Further, and without limiting the foregoing, no license or any right of any kind (whether by express license, implied license, the doctrine of exhaustion, or otherwise) is granted under any NI patents (whether identified herein or not) or other intellectual property right of NI with respect to any other product(s) of NI or of any third party, including the right to use any of these other products.\par 11.\tab\ul Patent and Trademark Notice.\ulnone For patents covering National Instruments products, refer to the appropriate location: \b Help\'bbPatents\b0 in the SOFTWARE, the patents.txt file on the CD-ROM, DVD-ROM, or ni.com/patents. National Instruments, NI, ni.com, and LabVIEW are trademarks of National Instruments Corporation. Refer to ni.com/trademarks for more information about National Instruments trademarks. Further, all other product and company names mentioned herein are (or may be) trademarks or trade names of their respective companies.\b\par \b0 12.\tab\ul Application Deployment.\ulnone You may distribute, deploy or otherwise make available Authorized Applications (along with applicable runtime engines for the SOFTWARE and applicable Driver Interface Software that you may include as part of or together with your Authorized Applications; and along with the Microsoft Silverlight software which may be provided by NI as Third Party Software if the Authorized Application is one created using such Microsoft Silverlight software) provided that you comply with each of the requirements set forth in sub-sections (A.) and (B.) below:\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj A.\tab\ul Deployment and Distribution Requirements.\ulnone \par \pard\nowidctlpar\fi-360\li1080\sb100\sa240\qj\tx1420 (1.)\tab You include the following copyright notice "Copyright \'a9 [insert year] National Instruments Corporation. All Rights Reserved." in the Authorized Application\u8242?s About Box (if applicable) and in (i) any applicable written documentation or, (ii) if no such documentation exists, in a "read me" or other .txt file distributed with each copy of the Authorized Application; (you may instead, or in addition, include your own copyright notice with the notice(s) required above, but in no event may you remove or alter any copyright, patent, trademark, or other legal notices or disclaimers that exist in the SOFTWARE; and, with respect to any runtime engines for the SOFTWARE and any Driver Interface Software that you may include as part of or together with your Authorized Application, your copyright notice shall be understood as protecting NI\rquote s copyrights in the SOFTWARE and shall not be understood as meaning that you have any copyright in or with respect to any SOFTWARE); \par (2.)\tab You do not use NI\u8242?s name, logo, or trademarks to market your Authorized Application without NI\u8242?s express prior written permission; \par (3.)\tab You shall indemnify, hold harmless, and defend NI from and against any and all claims, demands, lawsuits, liabilities, losses, damages, costs and expenses, including attorneys\u8242? fees, that arise or result from the use or distribution of your Authorized Application, \b AND EVEN IF DUE IN PART TO NI\u8242?S CONCURRENT NEGLIGENCE OR OTHER FAULT OR STRICT LIABILITY WITHOUT REGARD TO FAULT; PROVIDED, HOWEVER, THAT YOUR CONTRACTUAL OBLIGATION OF INDEMNIFICATION SHALL NOT EXTEND TO THE PERCENTAGE OF THE CLAIMANT\u8242?S DAMAGES OR INJURIES OR THE SETTLEMENT AMOUNT ATTRIBUTABLE TO NI\u8242?S NEGLIGENCE OR OTHER FAULT OR TO STRICT LIABILITY IMPOSED UPON NI AS A MATTER OF LAW;\b0 \par (4.)\tab You conform to all of the requirements of the Third Party Software license agreements provided with the SOFTWARE, including complying with any provisions in the Third Party Software licenses regarding copyright notices; \par (5.)\tab The Authorized Application is not and will not consist of or include any malicious, deceptive, or unlawful programs; and \par \pard\nowidctlpar\fi-720\li1440\sb100\sa240\qj\tx1170 (6.)\tab a.\tab If you distribute to any third parties your Authorized Application with any run-time engine for the SOFTWARE or Driver Interface Software, you either pass through to your end users this Agreement, or license the Authorized Application and any run-time engine for the SOFTWARE and Driver Interface Software distributed with the Authorized Application, subject to your own license agreement that is substantially in accordance with this Agreement and with at least the following provisions: (i) a disclaimer of implied warranties and consequential damages in favor of you and your licensors; (ii) a restricted rights provision substantially similar to the Section of this Agreement entitled "U.S. Government Rights"; and (iii) restrictions against (a) reverse engineering, decompiling, or disassembling the SOFTWARE (except to the extent such foregoing restriction is expressly prohibited by applicable law); (b) sub-licensing, leasing, lending or renting the SOFTWARE; (c) distributing in whole or in part, modifying, or creating derivatives of the SOFTWARE; (d) using any H.264/MPEG-4 AVC and/or VC-1 technology or codecs included in or with Microsoft Silverlight software which may be provided by NI as Third Party Software, including for the purpose of encoding or decoding video in compliance with, or making use of, the H.264/AVC visual standard or the VC-1 video standard; (e) taking any action that results in any SOFTWARE being subject to an Excluded License; (f) directly or indirectly, exporting, re-exporting, downloading, transmitting or shipping the SOFTWARE in violation of Section 21.D. or otherwise in violation of any applicable laws or regulations, including those of the U.S., the European Union or the jurisdiction in which the SOFTWARE is used or downloaded; and (g) (if your Authorized Application enables the use of Scripting) using the Scripting functionality to create applications which perform the functionality of an editor for a graphical programming environment; and\par \pard\nowidctlpar\fi-360\li1440\sb100\sa240\qj\tx1420 b.\tab If you distribute to any third parties your Authorized Application with Microsoft Silverlight software which may be provided by NI as Third Party Software, then, in addition to complying with the other requirements of this Section 12. A. (6.), \par \pard\fi-432\li1858\sa200\sl240\slmult1\qj (i)\tab you use the installer builder tool provided by NI with the SOFTWARE to create an installer for your Authorized Application and you include the installer that NI provides for the Microsoft Silverlight software in the installer for your Authorized Application, or you distribute your Authorized Application with the installer that NI provides at the following URL: {\field{\*\fldinst{HYPERLINK "http://digital.ni.com/express.nsf/bycode/InstallerForMicrosoftSilverlight"}}{\fldrslt{\ul\cf1 http://digital.ni.com/express.nsf/bycode/InstallerForMicrosoftSilverlight}}}\f0\fs18 , and, in either case, you do not modify the installer that NI provides or the installer experience (including display of the Microsoft Silverlight End User License Agreement and Privacy Statement); \par (ii)\tab you provide the "Notice About the H.264/AVC Visual Standard and The VC-1 Video Standard" found in the Third Party Software license agreement for the Microsoft Silverlight software to such third parties, and ensure that such Notice is provided to others who may receive a copy of your Authorized Application with the Microsoft Silverlight software (such notice automatically being installed via the installer that NI provides for the Microsoft Silverlight software as described in Section 12. A. (6.) b. (i)); and\par (iii)\tab after 30 days of being notified by NI of a Critical Update to the Microsoft Silverlight software, any new version of your Authorized Application must contain the updated version of the Microsoft Silverlight software. \par \pard\fi-360\li720\sa200\sl240\slmult1\qj B.\tab\ul Fees.\ulnone Generally, you may distribute, deploy or otherwise make available Authorized Applications without paying additional fees to NI. If, however, the Authorized Application was created utilizing any of the SOFTWARE identified in NI\u8242?s Deployment Licenses listing web page, which web page is currently located at the following URL, or any SOFTWARE added by NI at any time to such listing or any similar successor listings: {\field{\*\fldinst{HYPERLINK "http://zone.ni.com/devzone/cda/tut/p/id/9561"}}{\fldrslt{\ul\cf1 http://zone.ni.com/devzone/cda/tut/p/id/9561}}}\f0\fs18 , or such other SOFTWARE as NI may from time to time designate, then you must (before distributing, deploying or otherwise making available the Authorized Application for use on any other computer) either: (i) verify that the recipient has a valid license to run the applicable Authorized Application on (or has a valid license for such SOFTWARE for) each computer on which the Authorized Application will be used; or (ii) obtain written distribution authorization from NI and (if required by NI) pay to NI a per copy distribution/development fee for each Authorized Application distributed, deployed or otherwise made available. In the case of any Driver Interface Software identified as being subject to the license verification or distribution authorization requirements stated above, if the Authorized Application utilizes, calls, or otherwise accesses any such Driver Interface Software, the Authorized Application shall be deemed to have been created utilizing such Driver Interface Software for purposes of this Section 12.B. \par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 13.\tab\ul Limited Warranty.\ulnone Except for SOFTWARE provided under an evaluation license which SOFTWARE is provided without warranty, NI warrants, for your benefit alone, that for a period of ninety (90) days from the date the SOFTWARE is shipped to you (or, if downloaded, from the date the SOFTWARE is first downloaded by you) (i) the SOFTWARE will perform substantially in accordance with the accompanying documentation, and (ii) the medium on which the SOFTWARE is recorded will be free from defects in materials and workmanship under normal use and service ("Limited Warranty"). Any replacement SOFTWARE will be warranted for the remainder of the original warranty period or thirty (30) days, whichever is longer. Some states/jurisdictions do not allow limitations on duration of an express or implied warranty, so the above or any other limitation provided herein may not apply to you. In such event, such warranties are limited to the minimum warranty period allowed by applicable law. You must obtain a Return Material Authorization number from NI before returning the SOFTWARE under warranty to NI and you agree to pay expenses for shipment to and from NI. The Limited Warranty is void if failure of the SOFTWARE has resulted from accident, abuse, misapplication, improper calibration by you, third party products (i.e., hardware or softwa      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ\]^_`ibcdefgh[jklmnopqryvwx|}~re) used by you which are not intended by NI for use with the SOFTWARE, utilization of an improper hardware or software key (if applicable), or unauthorized maintenance of the SOFTWARE. \par 14. \tab\ul Customer Remedies.\ulnone NI\u8242?s sole obligation (and your sole remedy) with respect to the foregoing Limited Warranty shall be to, at NI\u8242?s option, return the fees paid by you to NI, in which event you must return or destroy all copies of the SOFTWARE in accordance with NI\u8242?s reasonable instructions, in which case the license granted to you shall terminate without liability on the part of NI by reason of such termination, or repair or replace the SOFTWARE, provided that NI receives written notice of applicable defects during the warranty period. You hereby agree not to bring an action to enforce your remedies under the foregoing Limited Warranty, or for breach of warranty, more than one (1) year after the accrual of such cause of action. \par 15.\tab\ul\b No Other Warranties.\ulnone EXCEPT AS EXPRESSLY SET FORTH ABOVE, NO WARRANTIES, EITHER EXPRESS OR IMPLIED ARE MADE WITH RESPECT TO THE SOFTWARE, THIRD PARTY SOFTWARE OR SOFTWARE SERVICES, INCLUDING ANY IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE OR NON-INFRINGEMENT. THERE ARE NO OTHER WARRANTIES THAT MAY ARISE FROM USAGE OF TRADE OR COURSE OF DEALING. NI DISCLAIMS ANY AND ALL IMPLIED WARRANTIES, INCLUDING IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT RELATING TO THE SOFTWARE, THIRD PARTY SOFTWARE, AND THE SOFTWARE SERVICES. NI DOES NOT WARRANT, GUARANTEE, OR MAKE ANY REPRESENTATIONS REGARDING THE USE OF OR THE RESULTS OF THE USE OF THE SOFTWARE OR SOFTWARE SERVICES IN TERMS OF CORRECTNESS, ACCURACY, RELIABILITY, OR OTHERWISE AND DOES NOT WARRANT THAT THE OPERATION OF THE SOFTWARE OR SOFTWARE SERVICES WILL BE UNINTERRUPTED OR ERROR FREE.\b0\par 16.\tab\ul Intellectual Property Liability.\ulnone NI shall, at its own expense, defend any claim brought against you by a third party resulting from your use of the SOFTWARE as authorized by your license, to the extent that such claim alleges that the SOFTWARE infringes any patent, copyright, or trademark of such third party protected by the laws of the U.S.A., Canada, Mexico, Japan, Australia, Switzerland, Norway, or the European Union, provided that such claim does not arise from your use of the SOFTWARE in combination with equipment, devices, software or code not made by NI, or from any modification of the SOFTWARE not made by NI, and further provided that you notify NI in writing immediately upon your obtaining notice of such impending claim and that you fully cooperate with NI in preparing a defense. If you provide to NI the authority, assistance, and information NI needs to defend or settle such claim, NI shall pay any final award of damages or settlement with respect to such claim and any expense you incur at NI\u8242?s written request, but NI shall not be liable for a settlement made without its prior written consent. If the SOFTWARE is held to be infringing of the rights stated above and the use thereof is enjoined NI shall, or if NI believes the SOFTWARE may be held to infringe a third party\u8242?s intellectual property rights NI may, at its option, either (i) procure for you the right to use the SOFTWARE; (ii) replace or modify the SOFTWARE with other software which does not infringe; or (iii) receive your return of the infringing SOFTWARE and refund to you the license fee payment(s) made by you to NI for the SOFTWARE. \b NI\u8242?S LIABILITY UNDER THIS SECTION 16, (INCLUDING THAT OF ITS LICENSORS AND SUPPLIERS AND ITS AND THEIR DIRECTORS, OFFICERS, EMPLOYEES, AND AGENTS, AND REGARDLESS OF THE REASON FOR SUCH LIABILITY) SHALL IN NO EVENT EXCEED IN THE AGGREGATE $50,000 (U.S.), AND IN NO EVENT SHALL NI BE OBLIGATED UNDER THIS SECTION 16 TO INCUR OR PAY, IN THE AGGREGATE, ANY AMOUNT IN EXCESS OF THE AMOUNT SET FORTH IN THIS SENTENCE. \b0 The foregoing states your sole remedy for, and NI\u8242?s entire liability and responsibility for, infringement of any patent, trademark, copyright, or other intellectual or industrial property right relating to the SOFTWARE. \b THIS LIMITED INDEMNITY IS IN LIEU OF ANY OTHER STATUTORY OR IMPLIED WARRANTY AGAINST INFRINGEMENT. THE FOREGOING OBLIGATIONS SHALL NOT APPLY TO ANY THIRD PARTY SOFTWARE, OR TO ANY THIRD PARTY PRODUCTS INCORPORATED IN OR OTHERWISE PROVIDED WITH THE SOFTWARE, AND YOU AGREE TO LOOK TO THE APPLICABLE THIRD PARTY MANUFACTURER WITH RESPECT TO ANY CLAIMS FOR INFRINGEMENT INVOLVING THIRD PARTY SOFTWARE OR THIRD PARTY PRODUCTS.\b0 \par 17.\tab\ul Limitation On Liability.\ulnone The entire liability of NI and its licensors, distributors, and suppliers (including its and their directors, officers, employees, and agents) is set forth above. \b TO THE MAXIMUM EXTENT PERMITTED BY APPLICABLE LAW, IN NO EVENT SHALL NI AND ITS LICENSORS, DISTRIBUTORS, AND SUPPLIERS (INCLUDING ITS AND THEIR DIRECTORS, OFFICERS, EMPLOYEES, AND AGENTS) BE LIABLE FOR ANY INDIRECT, INCIDENTAL, SPECIAL, PUNITIVE, EXEMPLARY, OR CONSEQUENTIAL DAMAGES OF ANY KIND; ANY EXPENSES, LOST PROFITS, LOST SAVINGS, BUSINESS INTERRUPTION, OR LOST BUSINESS INFORMATION; OR ANY OTHER DAMAGES, EXCEPT DIRECT DAMAGES NOT EXCEEDING IN THE AGGREGATE THE LICENSE FEE PAID FOR THE SOFTWARE PRODUCT INVOLVED; ARISING OUT OF THE USE OR INABILITY TO USE THE SOFTWARE OR THIRD PARTY SOFTWARE, ANY TECHNICAL SUPPORT SERVICES RELATING TO THE SOFTWARE OR THE THIRD PARTY SOFTWARE, OR RELATED HARDWARE, EVEN IF NI OR ITS LICENSORS, DISTRIBUTORS, AND SUPPLIERS HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES; AND REGARDLESS OF WHETHER CAUSED OR CONTRIBUTED TO BY THE NEGLIGENCE OF NI OR OTHERS\b0 . You acknowledge that the applicable fees and prices reflect this allocation of risk. Because some states/jurisdictions do not allow the exclusion or limitation of liability for consequential or incidental damages, the above limitation may not apply. If the foregoing limitation of liability is not enforceable because the SOFTWARE, the Third Party Software, the services, or the hardware is determined by a court of competent jurisdiction in a final, non-appealable judgment to be defective and to have directly caused bodily injury, death, or property damage, in no event shall the aggregate liability of NI, its licensors, distributors, and suppliers for property damage exceed the greater of $50,000 (U.S.) or the license fee paid for the SOFTWARE.\par 18.\tab\ul\b Warning.\ulnone (1) NI PRODUCTS ARE NOT DESIGNED WITH COMPONENTS AND TESTING FOR A LEVEL OF RELIABILITY SUITABLE FOR USE IN OR IN CONNECTION WITH SURGICAL IMPLANTS OR AS CRITICAL COMPONENTS IN ANY LIFE SUPPORT SYSTEMS WHOSE FAILURE TO PERFORM CAN REASONABLY BE EXPECTED TO CAUSE SIGNIFICANT INJURY TO A HUMAN. (2) IN ANY APPLICATION, INCLUDING THE ABOVE, RELIABILITY OF OPERATION OF THE SOFTWARE PRODUCTS CAN BE IMPAIRED BY ADVERSE FACTORS, INCLUDING FLUCTUATIONS IN ELECTRICAL POWER SUPPLY, COMPUTER HARDWARE MALFUNCTIONS, COMPUTER OPERATING SYSTEM SOFTWARE FITNESS, FITNESS OF COMPILERS AND DEVELOPMENT SOFTWARE USED TO DEVELOP AN APPLICATION, INSTALLATION ERRORS, SOFTWARE AND HARDWARE COMPATIBILITY PROBLEMS, MALFUNCTIONS OR FAILURES OF ELECTRONIC MONITORING OR CONTROL DEVICES, TRANSIENT FAILURES OF ELECTRONIC SYSTEMS (HARDWARE AND/OR SOFTWARE), UNANTICIPATED USES OR MISUSES, OR ERRORS ON THE PART OF THE USER OR APPLICATIONS DESIGNER (ADVERSE FACTORS SUCH AS THESE ARE HEREAFTER COLLECTIVELY TERMED "SYSTEM FAILURES"). ANY APPLICATION WHERE A SYSTEM FAILURE WOULD CREATE A RISK OF HARM TO PROPERTY OR PERSONS (INCLUDING THE RISK OF BODILY INJURY AND DEATH) SHOULD NOT BE RELIANT SOLELY UPON ONE FORM OF ELECTRONIC SYSTEM DUE TO THE RISK OF SYSTEM FAILURE. TO AVOID DAMAGE, INJURY, OR DEATH, THE USER OR APPLICATION DESIGNER MUST TAKE REASONABLY PRUDENT STEPS TO PROTECT AGAINST SYSTEM FAILURES, INCLUDING BACK-UP OR SHUT DOWN MECHANISMS. BECAUSE EACH END-USER SYSTEM IS CUSTOMIZED AND DIFFERS FROM NI\u8242?S TESTING PLATFORMS AND BECAUSE A USER OR APPLICATION DESIGNER MAY USE NI PRODUCTS IN COMBINATION WITH OTHER PRODUCTS IN A MANNER NOT EVALUATED OR CONTEMPLATED BY NI, THE USER OR APPLICATION DESIGNER IS ULTIMATELY RESPONSIBLE FOR VERIFYING AND VALIDATING THE SUITABILITY OF NI PRODUCTS WHENEVER NI PRODUCTS ARE INCORPORATED IN A SYSTEM OR APPLICATION, INCLUDING THE APPROPRIATE DESIGN, PROCESS, AND SAFETY LEVEL OF SUCH SYSTEM OR APPLICATION. \par \b0 19.\tab\ul U.S. Government Rights.\ulnone The SOFTWARE is a "commercial item" developed exclusively at private expense, consisting of "commercial computer software" and "commercial computer software documentation" as such terms are defined or used in the applicable U.S. acquisition regulations. If you are an agency, department, or other entity of the United States Government, the SOFTWARE is licensed hereunder (i) only as a commercial item and (ii) with only those rights as are granted to all other licensees pursuant to the terms and conditions of this Agreement. You agree not to use, duplicate, or disclose the SOFTWARE in any way not expressly permitted by this Agreement. Nothing in this Agreement requires NI to produce or furnish technical data for or to you. \par 20.\tab\ul Compliance.\ulnone \par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj A.\tab You agree to make all applicable records available for review by NI during your normal business hours so as to permit NI (upon reasonable notice to you) to verify your compliance with the terms and conditions of this Agreement. Further, if you are a business or other entity, you agree that upon the request of NI or NI\u8242?s authorized representative, you will promptly document and certify in writing to NI that your and your employees\u8242? use of the SOFTWARE complies with the terms and conditions of this Agreement. NI may (upon written notice) inspect your use of the SOFTWARE during your normal business hours to ensure your compliance with this Agreement. If the results of any such inspection indicate the underpayment by you of applicable fees due and payable to NI, you shall (i) immediately pay such amounts to NI; and (ii) reimburse NI for the cost of such inspection. \par B.\tab You agree that the SOFTWARE may collect and communicate certain software, hardware, and use information to NI\rquote s (or its service providers') servers for the purposes of (i) checking for and performing any updates, (ii) ensuring that you have complied and are complying with the terms and license conditions in this Agreement, including your use of valid software key codes or hardware keys or both, and (iii) NI's internal product development. The information collected and communicated does not include any proprietary application data. NI will not provide any of the information to any third party except as required (i) by law or legal process, or (ii) to enforce compliance with the terms and license conditions in this Agreement, including your use of valid software key codes or hardware keys or both.\par \pard\nowidctlpar\fi-360\li360\sb100\sa240\qj\tx426 21.\tab\ul General.\ulnone \par \pard\nowidctlpar\fi-357\li714\sb100\sa240\qj A.\tab If the SOFTWARE is manufactured in the Republic of Ireland, (1) (i) this Agreement is governed by the laws of the Republic of Ireland, exclusive of any provisions of the United Nations Convention on the International Sale of Goods, and without regard to principles of conflicts of law; and (ii) the non-exclusive venue for all actions under this Agreement shall be in the courts located in Dublin, the Republic of Ireland and the parties agree to submit to the jurisdiction of such courts; otherwise (2) (i) this Agreement is governed by the laws of the State of Texas, U.S.A., exclusive of any provisions of the United Nations Convention on the International Sale of Goods, and without regard to principles of conflicts of law; and (ii) the non-exclusive venue for all actions under this Agreement shall be in the courts located in Travis County, Texas, U.S.A. and the parties agree to submit to the jurisdiction of such courts. \par \pard\fi-357\li714\qj B.\tab This Agreement (and if applicable the VLP Documentation and the EP Documentation) constitutes the complete agreement between you and NI regarding the SOFTWARE and supersedes any oral or written proposals, prior agreements, purchase orders, or any other communication between you and NI relating to the subject matter of this Agreement. If there is a conflict between the terms and conditions of this National Instruments Software License Agreement and any applicable Specific Product Addendum, the terms and conditions of the Specific Product Addendum shall prevail and control with respect to the SOFTWARE product(s) to which the Specific Product Addendum applies. If there is a conflict between the terms and conditions of this Agreement and the VLP Documentation or the EP Documentation, the terms and conditions of this Agreement shall prevail and control. NI\u8242?s applicable standard Terms and Conditions of Sale, the current version of which is set forth at {\field{\*\fldinst{HYPERLINK "http://www.ni.com/legal/termsofsale"}}{\fldrslt{\ul\cf1 http://www.ni.com/legal/termsofsale}}}\f0\fs18 , shall apply as applicable with respect to any technical support services provided as part of the Software Services, and to any Training & Certification Services provided under an EP, provided, however that in any event the provisions of this Agreement shall apply and control with respect to any Upgrades or other SOFTWARE which may be provided as part of or in connection with any such services. No delay or omission by NI to exercise any right or power it has under this Agreement shall impair or be construed as a waiver of such right or power. A waiver by NI of any breach of any provision hereof shall not be construed to be a waiver of any succeeding breach of that provision or of any breach of any other provision. No modification of this Agreement shall be effective unless set forth in a writing signed by a duly authorized representative of you and NI. The word "including" as used in this Agreement shall be understood as meaning "including without limitation". If you are unable to access the internet to view any of the web pages referred to in this Agreement, you may request the information from your local NI sales office.\par \pard\nowidctlpar\fi-357\li714\sb100\sa240\qj C.\tab If any action is brought by either party to this Agreement against the other regarding the subject matter hereof, the prevailing party shall be entitled to recover, in addition to any relief granted, reasonable attorney fees and court costs. If any provision of this Agreement is held invalid, the offending clause will be modified so as to be enforceable and, as modified, shall be fully enforced, and the remainder of this Agreement will continue in full force and effect. \par \pard\fi-360\li720\sa200\sl240\slmult1\qj D.\tab The SOFTWARE is, and Third Party Software provided by NI with the SOFTWARE may be, subject to control under the U.S. Export Administration Regulations (15 CFR Part 730 et. seq.), other applicable U.S. export control laws and regulations, and applicable global export control laws and regulations, including, for products exported from the European Union, the Council Regulation (EC) No. 428/2009 (the "Regulation") and the Hungarian Government Decree No. 50/2004 (III. 23.). You agree that you will not export, re-export or transfer any SOFTWARE or Third Party Software provided by NI with the SOFTWARE via any means to any prohibited destination, entity or individual without the required export license(s) or authorization(s) from the U.S. Government and/or other applicable export licensing authority. NI reserves the right not to ship or permit downloading of the SOFTWARE ordered if, at any time, NI believes that such shipment or downloading of such SOFTWARE or any Third Party Software provided by NI with such SOFTWARE, may violate U.S. and/or other applicable export control laws. If you are downloading the SOFTWARE, you hereby represent and warrant to NI as follows: (i) you are not located in, or under the control of, any country the laws and regulations of which prohibit importation of the SOFTWARE or any Third Party Software provided by NI with the SOFTWARE; and (ii) you are not located in, or under the control of, any country to which the laws and regulations of the U.S. and/or other applicable export control laws prohibit exportation of the SOFTWARE or any such Third Party Software. For text of the relevant legal materials, see {\field{\*\fldinst{HYPERLINK "http://www.ni.com/legal/export-compliance.htm"}}{\fldrslt{\ul\cf1 http://www.ni.com/legal/export-compliance.htm}}}\f0\fs18 .\par \pard\nowidctlpar\fi-360\li720\sb100\sa240\qj (c) 2001\endash 2013 National Instruments. All Rights Reserved. \par 370406T-01\par \pard\nowidctlpar\fi-360\li720\sb100\qj May 2013\par }Text13{&Arial8}License AgreementLine12Line3Text14{&MSSansSerif8}You must accept with the license agreement below to proceed.Start_Installation_DialogInstallNowText50Text51{&MSSansSerif8}Click the Back button to reenter the installation information or click Cancel to exit the wizard.Line29Text244{&MSSansSerif8}Click Next to begin installation.Text26{&Arial8}Ready to Modify the ApplicationText2512{&Arial8}Ready to Repair the ApplicationText251{&Arial8}Ready to Install the ApplicationText2513{&Arial8}Ready to Resume [ProductName] installationLine5Installation WizardProgress_DialogActionProgress95ProgressBarText27{&Arial8}Updating SystemTimeRemainingText28{&MSSansSerif8}The features you selected are currently being installed.Line43Line7Text57{&MSSansSerif8}The features you selected are currently being uninstalled.Exit_DialogOK{&MSSansSerif8}FinishPushButton1{&Arial14}[ProductName] has been successfully installed.Line11Text56{&Arial14}[ProductName] has been successfully uninstalled.Text6{&MSSansSerif8}Click the Finish button to exit this installation.User_Exit{&MSSansSerif8}OK{&MSSansSerif8}[ProductName] was interrupted before your new software was fully installed. You can rerun this installation at another time to complete the setup of this software.WaitForCostingTextMessage{&MSSansSerif8}Please wait while the installer determines your disk space requirements...Single_Feature_DestinationText42{&MSSansSerif8}Setup will install the files for [ProductName] in the following folder. To install into a different folder, click the Browse button, and select another folder.Text43INSTALLDIR[INSTALLDIR]Text47Text19{&MSSansSerif8}Select a folder where the application will be installed.{&MSSansSerif8}LabVIEW FolderText18{&Arial8}Destination FolderText42a{&MSSansSerif8}You can choose not to install [ProductName] by clicking Cancel to exit the Installation Wizard.PushButton44Line17User_Information_DialogNameQ{&MSSansSerif8}Full N&ame:NameEEditUSERNAME{47}OrgQ{&MSSansSerif8}&Organization:OrgECOMPANYNAME{53}PIDQ{&MSSansSerif8}Product &ID:PIDEMaskedEditPIDKEY[PIDTemplate]Text8{&MSSansSerif8}The settings for this application can be installed for the current user or for all users that share this computer. You must have administrator rights to install the settings for all users. Install this application for:InstallMode.LVRT.NBFIFO.2013Text16{&Arial8}User InformationLine15Text46Line4Text7{&MSSansSerif8}Enter the following information to personalize your installation.No{&MSSansSerif8}&ResumeYes{&MSSansSerif8}&Exit Setup{&MSSansSerif8}Installation is not complete. If you quit the setup program now, the application will not be installed. You can run the setup program at a later time to complete the installation.Text2515{&MSSansSerif8}To continue installing, click Resume. To quit the setup program, click Exit Setup.AdminInstallBrowseTailText{&MSSansSerif8}&Selected path:TailPathEditTARGETDIRComboText{&MSSansSerif8}&Location of folder:ComboDirectoryComboUpNewFolderNewListDirectoryListResume_Install_Dialog{&MSSansSerif8}Are you ready to continue the installation?{&MSSansSerif8}Are you ready to complete your suspended installation?Text31{&Arial14}Resuming the [ProductName] SetupMaintenance_Welcome_DialogSomethingElse1MaintenanceModeLine402TypicalText7{&MSSansSerif8}Uninstall [ProductName] from this computer.Icon30Iconicon{&MSSansSerif8}Select the maintenance operation to perform.Icon29CustomLine426Text52CustomText5{&MSSansSerif8}Reinstall missing or corrupt files, registry keys, and shortcuts. Preferences stored in the registry may be reset to default values.Line8Text3{&Arial8}Application MaintenanceIcon8trash1Line39CompleteText3{&MSSansSerif8}Change which application features are installed. Displays the Select Features dialog, which lets you configure individual features.Line414Fatal_Error{&MSSansSerif8}Installation ended prematurely because of an error.{&MSSansSerif8}&Folder name:{&MSSansSerif8}&Look in:Setup_Dialog{&MSSansSerif8}Please wait while the Setup prepares the Windows Installer.Line2Text15Admin_Install_PointEditQ{&MSSansSerif8}Network &installation point:Back{&MSSansSerif8}Where would you like to create your installation?Text54Text36{&Arial8}Admin InstallationLine34Line35{&MSSansSerif8}The current selections require the following amount of disk space on the different volumes. The highlighted volumes do not have enough disk space available for the currently selected features.VolumeCostListErrorDialogErrorText{&MSSansSerif8}&YesA{&MSSansSerif8}&AbortCI{&MSSansSerif8}&IgnoreN{&MSSansSerif8}&NoO{&MSSansSerif8}&OKR{&MSSansSerif8}&RetryPictureMusicFilesInUseRetryIgnore{&MSSansSerif8}Files that need to be updated are in use.ListBoxFileInUseProcessExit{&MSSansSerif8}&ExitBitmap62Text60{&MSSansSerif8}Listed below are busy files followed by the application that's using the file. Close the application and click Retry, or click Ignore to replace the files after a reboot. Clicking Exit quits the installation.Line59Line45Text58{&Arial8}Files In UseReinstallModeReinstallRepairCheckBox{&MSSansSerif8}&Repair all detected reinstall problemsReinstallFilePresent{&MSSansSerif8}Reinstall only if file is missingReinstallFileOlderVersion{&MSSansSerif8}Reinstall if file is missing, or an older version existsReinstallFileEqualVersion{&MSSansSerif8}Reinstall if file is missing, or an older or equal version existsReinstallFileExactReinstallFileDifferingVersion{&MSSansSerif8}Reinstall if existing file has a different versionReinstallFileChecksum{&MSSansSerif8}Reinstall if EXE or DLL has an invalid checksumReinstallFileForceReinstallFileForceAll{&MSSansSerif8}&Force all files to be reinstalled, regardless of checksum or versionReinstallUserData{&MSSansSerif8}Verify that required &user registry entries are presentReinstallMachineData{&MSSansSerif8}Verify that required local &machine registry entries are presentReinstallShortcut{&MSSansSerif8}Validate shortcutsFirstRun{\TimesItalicBlue10}N&ame:{\TimesItalicBlue10}&Organization:{\TimesItalicBlue10}Please, enter the product &ID found on your CD box.OutOfDisk{&MSSansSerif8}Out of disk space. The highlighted volumes do not have enough disk space available for the selected features.Admin_Verify_Ready{&MSSansSerif8}Are you ready to install?Line1Text37{&Arial8}Admin Installation Verify ReadyText55Verify_Remove_AllRemoveNow{&MSSansSerif8}This will remove [ProductName] from your machine. Are you sure you want to continue? Click the Next button to remove the application. Click the Cancel button to exit the uninstall process.Text32{&Arial14}[ProductName] UninstallLine9Readme_Dialog{&MSSansSerif8}The following information describes this installation.Text45{&Arial8}Readme InformationDialogHCenteringVCenteringControl_FirstControl_DefaultControl_CancelFatal Error[ProductName] Reinstall Mode Dialog[ProductName] Identity DialogUITextKeyAbsentPathbytesGBKBMBMenuAbsentEntire feature will be unavailableMenuCDWill be installed to run from CDMenuLocalWill be installed on local hard driveMenuNetworkWill be installed to run from networkFldr|New FolderSelAbsentAbsentThis feature will remain uninstalledSelAbsentCDThis feature will be installed to run from CDSelAbsentLocalThis feature will be installed on the local hard driveSelAbsentNetworkThis feature will be installed to run from the networkSelCDAbsentThis feature will be uninstalled completely, you won't be able to run it from CDSelCDCDThis feature will remain to be run from CDSelCDLocalThis feature will change from run from CD state to be installed on the local hard driveSelChildCostNegThis feature frees up [1] on your hard drive.SelChildCostPosThis feature requires [1] on your hard drive.SelLocalAbsentThis feature will be completely removedSelLocalCDThis feature will be removed from your local hard drive, but will be still available to run from CDSelLocalLocalThis feature will remain on your local hard driveSelLocalNetworkThis feature will be removed from your local hard drive, but will be still available to run from the networkSelNetworkAbsentThis feature will be uninstalled completely, you won't be able to run it from the networkSelNetworkLocalThis feature will change from run from network state to be installed on the local hard driveSelNetworkNetworkThis feature will remain to be run from the networkSelParentCostNegNegThis feature frees up [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures free up [4] on your hard drive.SelParentCostNegPosThis feature frees up [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures require [4] on your hard drive.SelParentCostPosNegThis feature requires [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures free up [4] on your hard drive.SelParentCostPosPosThis feature requires [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures require [4] on your hard drive.VolumeCostAvailableAvailableVolumeCostDifferenceDifferenceVolumeCostRequiredRequiredVolumeCostSizeDisk SizeVolumeCostVolumeVolumeSelNetworkAdvertiseThis feature will change from run from network state to set to be installed when requiredSelLocalAdvertiseThis feature will be removed from your local hard drive, but will be set to be installed when requiredSelCostPendingCompiling cost for this feature...SelCDAdvertiseThis feature will change from run from CD state to set to be installed when requiredSelAdvertiseNetworkThis feature will be available to run from the networkSelAdvertiseLocalThis feature will be installed on your local hard driveSelAdvertiseCDThis feature will be available to run from CDSelAdvertiseAdvertiseWill be installed when requiredSelAdvertiseAbsentThis feature will become unavailableSelAbsentAdvertiseThis feature will be set to be installed when requiredMenuAllNetworkEntire feature will be installed to run from networkMenuAllLocalEntire feature will be installed on local hard driveMenuAllCDEntire feature will be installed to run from CDScriptInProgressMenuAdvertiseFeature will be installed when requiredValuerpoedcaumsRegistryRootComponent_ControlEventControl_EventArgumentOrderingNewDialogRESUMENOT RESUME AND ProductID AND PreselectedNOT RESUME AND ProductID AND NOT PreselectedSpawnDialog1SelectionBrowseSpawnWaitDialogCostingComplete = 1OutOfDiskSpace = 1OutOfDiskSpace <> 1InstalledNOT Installed0ReinstallALLMaintenanceMode="Repair"EndDialogReturnInstallMode.LVRT.NBFIFO.2013 <> "Custom" AND NOT Installed AND NOT RESUME AND NOT PreselectedInstalled AND MaintenanceMode="Modify"NOT Installed AND NOT RESUME AND PreselectedNOT Installed AND RESUMEInstallMode.LVRT.NBFIFO.2013 = "Custom"Installed AND MaintenanceMode = "Repair"InstallMode.LVRT.NBFIFO.2013 <> "Custom"LVRT_NBFifo.LVRT.NBFIFO.2013[_BrowseProperty]ValidateProductIDProductID <> "none"ProductID AND PreselectedProductID AND NOT Preselected[ALLUSERS]ApplicationUsers.LVRT.NBFIFO.2013 <> "AllUsers" OR NOT AdminUser{}ReinstallRepair.LVRT.NBFIFO.2013SetTargetPathDirectoryListUpDirectoryListNewMaintenanceMode = "Modify"MaintenanceMode = "Repair"MaintenanceMode = "Remove"ocmusBaseBrowseNOT BaseBrowseErrorYesErrorAbortErrorCancelErrorIgnoreErrorNoErrorOkErrorRetry[REINSTALLMODE]ReinstallFileOlderVersion.LVRT.NBFIFO.2013[WiseUninstall]MediaDiskIdLastSequenceDiskPromptCabinetVolumeLabelSourceALL MSIRESTARTMANAGERCONTROL=DisableLVRT_00.cabDirectoryDirectory_ParentDefaultDirLV2013RTEDIR.SourceDirControlConditionHideEnableAccept.LVRT.NBFIFO.2013 <> "Yes"DefaultDisableApplicationUsers.LVRT.NBFIFO.2013 = "AllUsers" AND AdminUserNot Installed OR MaintenanceMode <> "Modify"Not Installed OR MaintenanceMode <> "Repair" OR RESUMEInstalled OR RESUMENOT RESUMEWiseUninstallNOT WiseUninstallProductID = "none"NOT AdminUser OR Version9XShowProductIDInstallExecuteSequenceSequenceRemoveExistingProductsInstallFinalizeInstallInitializeRadioButtonOrder{\Tahoma10}&Advertise{\Tahoma10}&Do not advertiseWiseInitPrefix.LVRT.NBFIFO.2013Typical{&Arial8}&TypicalComplete{&Arial8}&Complete{&Arial8}C&ustom{&MSSansSerif8}I &do not accept the license agreement{&MSSansSerif8}I &accept the license agreementAllUsers{&MSSansSerif8}&Anyone who uses this computerOnlyCurrentUser{&MSSansSerif8}Only for &me ([USERNAME])Modify{&Arial8}&ModifyRepair{&Arial8}&Repair{&Arial8}R&emoveAdminUISequenceExecuteActionEventMappingAttributeSelectionNoItemsEnabledSelectionDescriptionSelectionActionSelectionSizeSelectionPathSelectionPathOnVisibleSetProgressProgressIgnoreChangeTextStyleArial9ArialBlueStrike10MS Sans SerifMSSansSerif10ArialArial8StyleBitsColorFaceNameArial10Arial13CourierBoldGreen12Courier NewArial14Times9Times New RomanArial12TimesItalic12TimesRed16MSSansSerif8TimesItalicBlue10TimesNew RomanMS_Sans_Serif8Tahoma15TahomaTahoma10Arial141LaunchConditionAdminUserThis installation must be performed by a user with local system administrative privileges.InstallUISequenceInstalled AND (RESUME OR Preselected) AND NOT PATCHMigrateFeatureStatesInstalled AND NOT RESUME AND NOT Preselected AND NOT PATCHAdminExecuteSequenceFeatureComponentsAAAAAA.199B8F20_5877_46B9_9657_7F18E7D681B0DAAAAA.199B8F20_5877_46B9_9657_7F18E7D681B0FileFileNameFileSizeVersionBAAAAA.199B8F20_5877_46B9_9657_7F18E7D681B0CAAAAA|nbfifo.dll3.1.0.491531033EAAAAA.199B8F20_5877_46B9_9657_7F18E7D681B0FAAAAA|rtvarsup.dllNIPathsRequestedProperty_ComponentComponentIdKeyPath{C8D1F4C5-FE57-4D4F-95E6-2190D299BF27}{CFAF53FC-58F0-4385-9EE5-89F41A4489CA}ManufacturerNational InstrumentsProductCode{EEDB0927-3BD8-4349-856E-425A146CC680}ProductLanguage9ProductVersion13.0.336{76E4763E-0DC4-4195-BC50-084193FFA84B}DefaultUIFontnoneMSIRESTARTMANAGERCONTROL_WiseDialogTitleFontDefault.LVRT.NBFIFO.2013InitializingWiseInitAdminError.LVRT.NBFIFO.2013{&Arial8}INSTALLLEVEL1000_WiseDebugMode.LVRT.NBFIFO.2013You must have administrator rights to run this installation. Please login as an administrator and re-run this installation.WiseInitSpaceError.LVRT.NBFIFO.2013WiseInitSuffix.LVRT.NBFIFO.2013Could not create temporary file, not enough free temporary disk space. Please free up disk space and rerun this installation.ReinstallFileVersion.LVRT.NBFIFO.2013Wizard...WiseInitExistError.LVRT.NBFIFO.2013NIARPVISIBLE.LVRT.NBFIFO.2013%s Version %s is already installed. You must uninstall the existing version before installing %s Version %s. Do you want to uninstall the existing version of %s?_WiseDialogFontDefaultPIDTemplate12345<###-%%%%%%%>@@@@@PROMPTROLLBACKCOSTPNIUpdateProductCode{F79021AC-51E7-4E1B-B6FF-FDABD12C7851}NIUpdateProductVersion13.0.0HIGHERVERSIONDETECTED.LVRT.NBFIFO.2013SecureCustomPropertiesNIUniquifyVersionAdvtExecuteSequence_ValidationColumnNullableMinValueMaxValueKeyTableKeyColumnCategorySetIdentifierPrimary key used to identify a particular feature record.Optional key of a parent record in the same table. If the parent is not selected, then the record will not be installed. Null indicates a root item.Short text identifying a visible feature item.Longer descriptive text describing a visible feature item.Numeric sort order, used to force a specific display ordering.The install level at which record will be initially selected. An install level of 0 will disable an item and prevent its display.UpperCaseThe name of the Directory that can be configured by the UI. A non-null value will enable the browse button.0;1;2;4;5;6;8;9;10;16;17;18;20;21;22;24;25;26;32;33;34;36;37;38;48;49;50;52;53;54Feature attributesInteger error number, obtained from header file IError(...) macros.Error formatting template, obtained from user ed. or localizers.Name of action to be described.Localized description displayed in progress dialog and log when action is executing.Optional localized format template used to format action data records for display during action execution.Unique key identifying the binary data.The unformatted binary data.GuidThe UpgradeCode GUID belonging to the products in this set.The minimum ProductVersion of the products in this set. The set may or may not include products with this particular version.The maximum ProductVersion of the products in this set. The set may or may not include products with this particular version.A comma-separated list of languages for either products in this set or products not in this set.The attributes of this product set.FormattedThe list of features to remove when uninstalling a product from this set. The default is "ALL".The property to set when a product in this set is found.External key to the Dialog table, name of the dialog.Name of the control. This name must be unique within a dialog, but can repeat on different dialogs. The type of the control.Horizontal coordinate of the upper left corner of the bounding rectangle of the control.Vertical coordinate of the upper left corner of the bounding rectangle of the control.Width of the bounding rectangle of the control.Height of the bounding rectangle of the control.A 32-bit word that specifies the attribute flags to be applied to this control.The name of a defined property to be linked to this control. A string used to set the initial text contained within a control (if appropriate).The name of an other control on the same dialog. This link defines the tab order of the controls. The links have to form one or more cycles!The help strings used with the button. The text is optional. Name of the dialog.Horizontal position of the dialog on a 0-100 scale. 0 means left end, 100 means right end of the screen, 50 center.Vertical position of the dialog on a 0-100 scale. 0 means top end, 100 means bottom end of the screen, 50 center.Width of the bounding rectangle of the dialog.Height of the bounding rectangle of the dialog.A 32-bit word that specifies the attribute flags to be applied to this dialog.A text string specifying the title to be displayed in the title bar of the dialog's window.Defines the control that has the focus when the dialog is created.Defines the default control. Hitting return is equivalent to pushing this button.Defines the cancel control. Hitting escape or clicking on the close icon on the dialog is equivalent to pushing this button.A unique key that identifies the particular string.The localized version of the string.A named property to be tied to the item.The value string associated with the item.Primary key, non-localized token.The predefined root key for the registry value, one of rrkEnum.RegPathThe key for the registry value.The registry value name.The registry value.Foreign key into the Component table referencing component that controls the installing of the registry value.A foreign key to the Dialog table, name of the dialog.A foreign key to the Control table, name of the controlAn identifier that specifies the type of the event that should take place when the user interacts with control specified by the first two entries.A value to be used as a modifier when triggering a particular event.A standard conditional statement that specifies under which conditions an event should be triggered.An integer used to order several events tied to the same control. Can be left blank.Primary key, integer to determine sort order for table.File sequence number for the last file for this media.Disk name: the visible text actually printed on the disk. This will be used to prompt the user when this disk needs to be inserted.If some or all of the files stored on the media are compressed in a cabinet, the name of that cabinet.The label attributed to the volume.The property defining the location of the cabinet file.Unique identifier for directory entry, primary key. If a property by this name is defined, it contains the full path to the directory.Reference to the entry in this table specifying the default parent directory. A record parented to itself or with a Null parent represents a root of the install tree.The default sub-path under parent's path.A foreign key to the Control table, name of the control.Default;Disable;Enable;Hide;ShowThe desired action to be taken on the specified control.A standard conditional statement that specifies under which conditions the action should be triggered.Name of action to invoke, either in the engine or the handler DLL.Optional expression which skips the action if evaluates to expFalse.If the expression syntax is invalid, the engine will terminate, returning iesBadActionData.Number that determines the sort order in which the actions are to be executed. Leave blank to suppress action.A named property to be tied to this radio button. All the buttons tied to the same property become part of the same group.A positive integer used to determine the ordering of the items within one list..The integers do not have to be consecutive.The value string associated with this button. Selecting the button will set the associated property to this value.The horizontal coordinate of the upper left corner of the bounding rectangle of the radio button.The vertical coordinate of the upper left corner of the bounding rectangle of the radio button.The width of the button.The height of the button.The visible title to be assigned to the radio button.The help strings used with the button. The text is optional.A foreign key to the Dialog table, name of the Dialog.An identifier that specifies the type of the event that the control subscribes to.The name of the control attribute, that is set when this event is received._SummaryInformationPropertyIdName of the style. The primary key of this table. This name is embedded in the texts to indicate a style change.A string indicating the name of the font used. Required. The string must be at most 31 characters long.The size of the font used. This size is given in our units (1/12 of the system font height). Assuming that the system font is set to 12 point size, this is equivalent to the point size.A long integer indicating the color of the string in the RGB format (Red, Green, Blue each 0-255, RGB = R + 256*G + 256^2*B).A combination of style bits.Expression which must evaluate to TRUE in order for install to commence.Localizable text to display when condition fails and install must abort.A named property to be tied to this item. All the items tied to the same property become part of the same listbox.The value string associated with this item. Selecting the line will set the associated property to this value.The visible text to be assigned to the item. Optional. If this entry or the entire column is missing, the text is the same as the value.Foreign key into Feature table.Foreign key into Component table.Primary key, non-localized token, must match identifier in cabinet. For uncompressed files, this field is ignored.Foreign key referencing Component that controls the file.FilenameFile name used for installation, may be localized. This may contain a "short name|long name" pair.Size of file in bytes (long integer).Version string for versioned files; Blank for unversioned files.List of decimal language Ids, comma-separated if more than one.Integer containing bit flags representing file attributes (with the decimal value of each bit position in parentheses)Sequence with respect to the media images; order must track cabinet order.Primary key used to identify a particular component record.A string GUID unique to this component, version, and language.Required key of a Directory table record. This is actually a property name whose value contains the actual path, set either by the AppSearch action or with the default setting obtained from the Directory table.Remote execution option, one of irsEnumA conditional statement that will disable this component if the specified condition evaluates to the 'True' state. If a component is disabled, it will not be installed, regardless of the 'Action' state associated with the component.File;Registry;ODBCDataSourceEither the primary key into the File table, Registry table, or ODBCDataSource table. This extract path is stored when the component is installed, and is used to detect the presence of the component and to return the path to it.Name of property, uppercase if settable by launcher or loader.String value for property. Never null or empty.Name of tableName of columnY;NWhether the column is nullableMinimum value allowedMaximum value allowedFor foreign key, Name of table to which data must linkColumn to which foreign key connectsText;Formatted;Template;Condition;Guid;Path;Version;Language;Identifier;Binary;UpperCase;LowerCase;Filename;Paths;AnyPath;WildCardFilename;RegPath;KeyFormatted;CustomSource;Property;Cabinet;Shortcut;URLString categorySet of values that are permittedDescription of columnModuleSignatureCDInfo3.2nimetautils.91D5760B_F9E8_4332_BFB1_38A4CB799A3ECommonFilesFolder.:COMMON~1|CommonFilesFolder.:PROGRA~1|ProgramFilesFolderProgramFilesFolder.:WINDOW~1|WindowsFolderWindowsFolder.:COMMON~3|CommonAppDataFolderCommonAppDataFolder.:PROGRA~2|ProgramFiles64FolderProgramFiles64Folder.:COMMON~2|CommonFiles64FolderCommonFiles64FolderNot NIDISABLENIMUNIMUMetaHook.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENot NIDISABLENIPATHSNIPaths2.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENot NIDISABLENIPATHS AND Not NIRUNNINGINMERGEDNIMUProcessNIPathsEnvironmentTable.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENot NIDISABLENIMU AND Not NIRUNNINGINMERGEDNIMUPersistPartRegInfo.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENot NIDISABLENIMU AND NIMETALAUNCHEDNIMUFeature.91D5760B_F9E8_4332_BFB1_38A4CB799A3E(NOT NIDISABLENIMU) AND (NOT REINSTALL~="ALL") AND (REINSTALL)NIMUSetReinstallProperty.91D5760B_F9E8_4332_BFB1_38A4CB799A3E(Not NIDISABLENIMU) AND (NOT REINSTALL) AND NIMETALAUNCHEDNIMUEvaluateNIConditionColumns.91D5760B_F9E8_4332_BFB1_38A4CB799A3EFindRelatedProductsNot InstalledNIFindRelatedProducts.91D5760B_F9E8_4332_BFB1_38A4CB799A3E(VersionNT >= 602) AND (Not NIDISABLETILECLEANUP) AND (Not NIRUNNINGINMERGED)NIMUManageWin8InstallTiles.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENot NIDISABLENIMUSETPERMISSIONS AND NOT NIRUNNINGINMERGEDNIMUSetPermissionsPreinstall.91D5760B_F9E8_4332_BFB1_38A4CB799A3E0Not NIDISABLENIMUSETPERMISSIONSNIMUSetPermissions.91D5760B_F9E8_4332_BFB1_38A4CB799A3E0NIMetaUtilsCA.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENIPaths.91D5760B_F9E8_4332_BFB1_38A4CB799A3ECustomActionTargetNIFindRelatedProductsNIMUEnsureCorrectFeatureStateNIMUMetaHookNIMUPersistPartRegInfo[REINSTALL],[NIMUMainFeatureName.91D5760B_F9E8_4332_BFB1_38A4CB799A3E]REINSTALLNIMUSetPermissionsNIMUEvaluateNIConditionColumnsNIPathsNIMUProcessNIPathsEnvironmentTableNIMUManageWin8InstallTilesModuleComponents3.2.0.351NIVersion.NIPaths.91D5760B_F9E8_4332_BFB1_38A4CB799A3E6/11/2013 4:51:51 PMNIBuildDate.NIPaths.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENIVersion.NIMetaUtilsCA.91D5760B_F9E8_4332_BFB1_38A4CB799A3E6/11/2013 4:52:02 PMNIBuildDate.NIMetaUtilsCA.91D5760B_F9E8_4332_BFB1_38A4CB799A3EMsiShortcutPropertyShortcut_PropertyKeyPropVariantValueEnvironment_NIOtherValidationValuesNormal_NIPathsCodePropertiesLVRTEDIRMAXDATADIRMAXDETECTEDMAXDIRMAXEXPERTDIRMAXFRAGDIRMAXHELPDIRMAXINSTDIRMAXUIDIRMSIENGINEVERSIONNUMERICNICSIDLCOMMONDOCUMENTSNINTPRODUCTINFOTYPE600NINTSTARTEREDITIONODBC32DETECTEDVISA32COMPANYNAMEVISAOSDIRVXIPNPOSDIRWindowsVolumeThe numeric custom action type, consisting of source location, code type, entry, option flags.Primary key, name of action, normally appears in sequence table unless private use.The table reference of the source of the code.CustomSourceExcecution parameter, depends on the type of custom actionComponent contained in the module.Default language ID for module (may be changed by transform).Module containing the component.Version of the module.Default decimal language of module.Module identifier (String.GUID).Canonical string representation of the Property Key being setString representation of the value in the propertyPrimary key, non-localized tokenForeign key into the Shortcut tableShortcutThe name of the environmental value.Foreign key into the Component table referencing component that controls the installing of the environmental value.The value to set in the environmental settings.Unique identifier for the environmental variable settingNI3rdPartyDependency1;4IntegerSatisfiedConditionDirectory;NIPathsRequested;_NIPathsCodePropertiesNI3rdPartyInstallCostDoubleIntegerCostLocalCostSourceInstallCostInstallCost_NI3rdPartyInstallCostMapNI3rdPartyInstallFakeFeatureReference_AdvertiseCmdAdvertiseConditionLocalCmdLocalConditionAnyPathMsiPathReferenceRemoveCmdSourceCmdSourceConditionForeign key in Component tableNIComponentCostHolds the file cost of the component in units of 4KBFileCostsIn4KBHolds the number of files in the componentNumFilesHolds the registry cost of the component.RegCostsNICustomExecuteCmdLineFormattedCustomExecuteTypeNIExecutableSpecialIdentifierNICustomExecuteProductNISummaryProductPackageCodeCodePageCommentsCompressedCreatorKeywordsMSISizeMsiVersionThe number of files that are in that productNumberFilesPlatformTotal disk cost of this productRollBackCostIn4KBSecuritySubjectUniquifierUseLongFilenamesNICustomExecutePublishNIMetaCustomExecuteNIExecutable_NIDirectoryProductNIDirectoryRestrictionParameterNIDisableDirectoryBrowseFatal or warningNIDistributionLaunc(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((y/ERQoHZ2WrG6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿJFIFHHC      C  :" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?((((((((((((((((((((((("' _~ҿp,д -J]> ௛. xʩu5N37OMͭg<5SQA=nGTW¿wK6xYեiϩMwxxH'+e+v->2xf5Y{Uv)*rH`TqpN+lUt%kNNTZU%k_>梾i,|Q'[}uu5MNxZx :?._gNZl~?x:ho 0Ez+ WVVx|BlpX8*/gf}E|E ~~._ >֋5i]"[m?6 /_p{|v~͟)nZ7#"&.k?F Lw㯁 53?|^þcmVXlh幕,m6a|e'0'4, ۾ y?a\?>.{',OhמR_[LDdVۻ*j+<cD5 J񵀿dku˵ʞV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 3si1mdl`98?`+֟ xėmi7WH 8exN I5;[]Sy N.)5[aWMjm3Xҧ0׺YN?`xz5+/¤Ӵ"md20 }ݿ_Y+,<gէuf.;d\W)Fiz=vRWObcEc{$Q'Q$< $X_k@/_?/5XC[>:F,V9.6mʰa)T_E ?f(5`nU4`!Pkki||d⦻- ^ƣ k/h:rHVUzVU&o?(R*Qd_q ~ uN[O|n>%MYcGgmjEL<;@/;=?q~7{>2?uK ǨBH]B||1݂yOc?L>7xk tOCjvW7|9ܸ$8⯀~7|!Wg=bj"Q?~ɟwǏg'G/~Ӛ>_\\MiϓSJ\j!e;HYOb/>!7#?-F]% {dz.ր?p??gٿ>,F@5muiDe7E9.zʿ/a)Ɵxz~oz?A&6ayE[Ym2R7n%bGoE |o㟊 >2E5ڦ/hQx.W ? |u70.(iO{6Ѫ%Ϝ'hTUhVb?d?f8|/| |K_A񕅮jofC#!"VbSn?'z Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@|5w 3Omn/-B+X,"RNq_KPFk&!+I;w\nzvΚk%/E+/5_ڝ m|O摮x>5 % Rmd/*p98/?,wkmѬ<6ҭ XCkg5WxwM—^)&s]A|ɤwXBShLρ>_tY "HX]F+ݨL-\ 5 /č4&y"HrG:`x|9~̟;΁w:}#Ry%J417RAl}1Exw?w7ᾅkqW򆙟K.E%`$l^ d#>-_z-=n%3L cy5fH|Gz~/Ң5Vu+(ƐJ%w܁sTu%'φ: 7[LL軹H~wH+ (W G<_tK_ĚLZr9#I9UI$ &Nӭ> KH!b$q"*銚((((((((((((((((((((((((((((((((((((((((((6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ?/E(]ʿ6RQoHZ+(WrGcͿ*/ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7 cơٵ֫,otQ,I\O+,_v.<S s|x_մw|Tcm*H{ԑ^OsqMIqܽb*e}ud'ޖONiv[Wni7:Mޥock%̩iFBͶ4D4{ŚǨxuD[oƙ>osw"I7*ctI!nwe|x-/4SD[]?XK?Kc$Glm]ؒQ?=¿v"մV}^;iy7E6KEf?h?kp1gSբNVi0̚ww:螗iKG쯫&k^3d+Yya>Z-cpEmBRHi7zz;x3- JY\I, @FoJ?c4uqoj=:}>VNVGj5W"Lϋ"e_'|Gɣ$5?nP\w$&4s xǙ,q*~zՑZYw^Χ~]gvs>}oeDMBŘXy#jŚ?׋|k9_GVi͵մ1%87H у 5ڢ ]ټLVAl nC$M*-Ϛ:'|_:`n[BiOy#rvcxoC4*^ּ5s]*k{ [G%P+KJ~(¿-󼿱l,/m;/nWn[KŸ| xz4,WQ{8/"5/3OeqVI׵G/59o%eu}mlT>$K8XX0Neiw_h o2vE׍/-n|1!q9b:lIhm̮]ںdDN߳'ěm T#/4u{Ю,m->ͭn4%bP7 /:uO{^8I|yt)ɮ kt(o"0uoE<M{zߕcKϔv7`Xۉs#0MRN{7{Ykuk̚x|UwY>o׋WuOL>M"g?eڇ|/vخ8sx!(5?jFrWKA666^GhUmT71NM]ֶ֒'oIfך/7T$J,!?_ |!}Zٗ:6[Wxf0!ƵwYXU "U6tVw~ƆXV[>Vy/|/Mօ]Vc:~g%վWMH.ea`z^oc]6|^:MōzD;ePDP*/@slObwR9/<CX{ g῵lqbˏEykGbkR3e{&š~mIȻ>)͂5>ɔ袯W*0ZVwNnf-,5n]riu_/v],StQ͌ju[Gguk.Tvo?ix7źyҮInXηGl>[B̨̥iwK_A?oqkKo_}wmf>}>;?W *y%o>!^x^uI-# ܎^·͌VuZ:(IB(lM}:405*.|rNW{[U{wS2߄φ|Z&a<ܺ 6Vb cbTې Tq'‘=~C7]\Zb) &Gs -P^Ij1;v`|_ZEut4:ֽ2\HYcxWZs=_k׭K[Wּ%xAb6:kY%-Xys6lҭN Z/jJMUs8o:niKiwP.>myڄvr5^[ۤhv<ADE?&=w .ChWA(^&$34JM C~$ǒ8.{ NfB~.~r*qk=r>"EzNΑgW)-ޛ{ ḽic2|QCu$C|zM5w[_ֶ߯KYѡq4i{kۧ[x_u>٧ZzcK;%ٗi(\K0":<V: V}[9"L>oCo>,s)W~)B]'R$Ӯ,QҮ;K't=4ۺ\ʡmp ߇~ví{NnZG:RVR?eQE#qRRӽ [}vޫaSVkߗk~7nٓNPu]xI]_hpWOYDdI%O1b;@xfυ:_n?^>k5Đ^ٻfOZO_.Ys>"o4{[vi776RoKM+Uo{xe<c>cOiҿh? 1w:RW* |*f0FҪ9cmmg~iGO֚鵻;e(c ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (? C1A5GEDjED+C&H{ C1A5G?3H > C1A5G=F > C1A5G>CD1H*A~]gcdt{(*0IE-QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEՓxQ\1G凹OlET1ETQEQEQEQEQEQEQE1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?诧t([?gNxٓd|E};G"qpP̟#*+E=@/ ?t(Ӈd1Q_N((   }00h(0`wwwxwwwxwwwLGwLDwLDwxLDDxLD@wwwwwxD@w@xw@xwwwwwxxwpwxppxppL̏xp̏xpxpxxDDDxwwwx̏xwwww̏xxxwwwwwwwxwwwwww???010 C1A5G>;ED0H)~ C1A5GE5ABH C1A5G=EA2 C1A5G>; H t JFIF``C    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222?" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?诧t([?gNxٓd|E};G"qpP̟#*+E=@/ ?t(Ӈd1Q_N-QG??'woK8E=@/ ??GTWӿx{:_-Q2>b[?oK88(fO"qx{:_iC2̏t([?Nٓd|E};G"qpP̟#*+E=@/ ?t(Ӈd1Q_N-QG??'woK8E=@/ ??GTWӿx{:_-Q2>b[?oK88(fO"qx{:_iC2̏t([?Nٓd|E};G"qpP̟#*+E=@/ ?t(Ӈd1Q_N-QG??'woK8E=@/ ??GTWӿx{:_-Q2>b[?oK88(fO"qx{:_iC2̏t([?Nٓd|E};G"qpP̟#*+E=@/ ?t(Ӈd1Q_N-QG??'woK8E=@/ ??GTWӿx{:_-Q2>b[?oK88(fO"qiC2̍j(c ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( |KrK],E)ZjZN[}B+>?Jr{>nW˹gVViWNUxF6dn5%Ǹׂ&o]2fRJ=땵o6& )x*Gpk ?kҩPk4RZ^\(9ځօU橯s3LsGrW~)i6{y-өXy [}>i4{hglzw$\xS #fyԩ=et[VO<&mD;=~5"m2+f#&[^oѯKkm[ VTIo9$~W|Umoۍ>+$qEYR?ڸ/I-.-cꫲ<#Zm^{Q0*@'^e{5 |=["ze4 ɵ6PkGXַi$\dE:u79Hga0̉Hy;K=܎AT=q=,QE1=]4=̓']{ױJpx5ZR%yfZOkUZS'wz21x'Jm4%RV@ƐƱĊ 0GU񇉵 TVZ(6b2t;zן:zl:^5ƍR:*үuWI:~rf`d+0BOw2!2/Yy[}]f&:J^ikBOڜ"$Ez,2]9 Fzc=|[5+&MZ,+Q N8㱠 Wu?;NXK3-" $y%xMo- 麕`RU_~A^i|-Kumn'\SF{5PuL'ݺ&e,V#ȞE }S"XzIcO#w٤fc _~)c-kEO{ EWt޶`W|M 6vZaI60#m95:n`߉t_L}>&Du,H=J \$ԓe p:u?- G©ݹH?DHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~xppxpwwwwĈ wwpHpwwwwwDxpxwpDGpwwDDxwwDwwwDwwwwwwwxwwxxwxxpwxwwwwwwwwwwwww w w DDGw  w wwwwwwwwwwwwwwwwwww ( @wwwwwwwwwwwwr"wwwwwwwwwwzwwwwwxwppwxww{pwwwwwwxwww{~pwww~wpwwwww{wpwxpwwwwwxxw{~wwwpxwwwwpxxxwwwwpwwwpxxxxwwwpwwwxwwwpwwwxxxpww~wwwzxxpwwwppzwwxwwwppzwwwwwwpwwwpwwpw@@@_@@_@ P( ppppAS+ &(( @ C1A5GEE~:A;98GO::?98G;K88:;9I:8H6:.Gpwpppppwwwwwpwwwwwpwwwpwwwpwpwwxwwwwwpxppwwwxwwwwp??( pwxppwwpwwwp%    #$(+.1468;=?BDFNNQQ  "')BCEHJKNRWY\agilmr!$'(*,.0246<>@BHIKLNPRTZ\^`bdfhjltvxz|~          & ( * , . 0 2 4 F H J L R T V X Z \ b d i k m o q s u w @H FE2DA7CrD`@H=>BhEA/C'A7CrDA/FE-/A@H=R>EED'BYEDhE7CE@$@H<ABv;hBlDED1H7C@H<ABv;EA7B'H$B @H<AB>BD&AD5HD@H<ABv;lE`'@H<AB;qFlErD0BE @H<ABv>hE0CEDE36@H<AB>FBAL@H<AB6?7AACrD(?(E8BA(H@H<AB?hE6CrDF0B5C&H2@H<AB?hE6CrDE5CBp@HDjEA(H o @HD'FEhConditionEULANIEULAInstallationTargetFileNIExtraFeatureInfoHeaderNIFakeFeatureNIFakeFeatureLinkDist;NI3rdPartyInstallFakeFeature;_NIOtherValidationValuesNIFakeFeatureLinkDistLinkedDistributionNIFakeFeatureMenuMenu_NIFakeFeatureMenuItemDefaultMenuItem_MenuMenuItemNIFakeFeatureMenuMenuItemMenuItem_NIFeatureDisplayNIFeatureProductFeatureSubsetNIFeatureSubsetFeatureFeatureSubset_NIFeatureSubsetFeaturesNIFeatureSubsetProductSubsetNameNIFeatureTransitiveNIFeatureTransitiveAttributesNIFileCostSequenceNIHideDialogUserInfo;SingleDirectory;FeatureInfo1;InstallationType;FeatureTree;NICertificate;License;License2;ConfirmStartNIInstallerDependencyNILegacyUninstallRegKeyRegNameRegRootNIMaxBaselineSummaryProductNIArpVisibleNIMediaProductDiskId_NIMergedPreserveRowsColumnValueCommentTableNameNIModuleComponentPropertyKeyComponentAttributes that affect how the product is cached.NIPartCacheInfoThe relative path of the core part to the product rootCorePartRelativePathFolder name the product uses when it is cachedProductCacheNameProductId generated by MetaBuilder for the product that contains this partProductIdAttributes that affect how the product is cached and de-dupedNIPartFileProductCode of the part this row originates fromThe path and name of a part's file.FilePathProductCode of a patch target part.NIPatchTargetThe UpgradeCode of a patch target part.ProductVersion of a patch target part.The ProductCode of the core part of the product that contains the patch target part.CorePartProductCodeThe ProductLanguage of a patch target part.Dir;Detected;VersionString;VersionNumeric;RawReadNIPathsDefinitionNIPathsDir;NIPathsDetected;NIPathsVersionNumeric;NIPathsVersionString;NIPathsRawReadNIPathsDetectedNIPathsRegLocatorNILocator_PathList;StdPath;StdVersion;RawNumeric;KeyDetectedInterpreterInterpreter ParamNILocatorPrecedenceHighestVersionKey;ThisKeyReaderReader ParamNIPathsDirDirectory;NIPathsDir;_NIPathsCodePropertiesParent_ShortDefaultValueExclusiveNIPathsEnvironmentComponentId_NIPath_String that specifies a location type. Valid values are 'Directory', 'File', or 'Registry'. (Required)Directory;File;RegistryNIPathsPermissionsOptional MSI condition. If the condition evaluates to TRUE or is empty, the permissions will be set on the location.Information about the location and the values of the fields. (Optional)Formatted string which evaluates to a file system path or registry key path. Prefix with root name in the form CLASSES_ROOT, CURRENT_USER, MACHINE, or USERS. Must be empty if LocationKey is specified; must be specified if LocationKey is empty.FormattedLocationForeign key into the Directory, File, or Registry table. Must be empty if FormattedLocation is specified; must be specified if FormattedLocation is empty.Directory;NIPathsDir;_NIPathsCodeProperties;File;RegistryLocationKeyPrimary key identifierNIPermissionsOptional string that defines custom permissions to set on the location. Leave blank to give full access to all authenticated users (recommended). If specifying, use Security Descriptor Definition Language (SDDL) to define the custom permissions.SecurityDescriptorDirectory;NIPathsRequested;_NIPathsCodeProperties;File;RegistryNIPathsRawReadFoundNotFoundNIPathsRemoveBackslashNewPropertyNIPathsStandAloneSequenceNIPathsVersionNumericNIPathsVersionStringNIProductPartNIProductPartProductPartProductCode_NIPropertyProductNISelfRegDependOnNIUpdMgrNoMoreNIUpgradeNIUpgradeProductAttributes_Language_PreventsInstallUpgradeCode_VersionMax_VersionMin_DetectedActiveSyncACTIVESYNCDETECTEDDirACTIVESYNCDIRAnalog Modulation Toolkit - CVI SupportAMTCVIDETECTEDCVIDIRAMTCVIDIRNIDIR, CVIVERSION, MEASUREMENTSTUDIODIRCVI highest installed VersionStringVersionStringAMTCVIVERSIONVersionNumericAMTCVIVERSIONNUMERICAnalog Modulation Toolkit - LabVIEW SupportAMTLVDETECTEDLVDIRAMTLVDIRNIDIR, LVVERSIONLabVIEW (highest installed VersionString)AMTLVVERSIONAMTLVVERSIONNUMERICAnalog Modulation Toolkit RuntimeAMTRTDETECTEDAMTRTVERSIONArdenceARDENCEDIRNI TestStand ATML Toolkit 1.0ATMLTK100DETECTEDNI TestStand ATML Toolkit 2.0ATMLTK200DETECTEDNI TestStand ATML Toolkit 3.0ATMLTK300DETECTEDDetects whether NI AudioMASTER is installed.AUDIOMASTERDETECTEDNIDIRRoot directory for NI AudioMASTER.AUDIOMASTERDIRAll NI ProductsVersion of NI AudioMASTER installed.AUDIOMASTERVERSIONAUDIOMASTERVERSIONNUMERICAnalog Waveform EditorAWEDETECTEDMAXAFWDIRAWEDIRAssistants Framework Dir; currently uses a dummy locatorAWEVERSIONAWEVERSIONNUMERICBorland C++ Builder 4.0BCB40DETECTEDBCB40PARENTDIRBCB40DIRRequired for BCB40DIRBorland C++ Builder 5.0BCB50DETECTEDBCB50PARENTDIRBCB50DIRRequired for BCB50DIRBlueNITE destination directory in local installation modeBLUENITEDIRBridgeVIEWBVDETECTEDBVDIRBVVERSIONBVVERSIONNUMERICCaliberation ExecutiveCALEXECDETECTEDCALEXECDIRCALEXECVERSIONCALEXECVERSIONNUMERICNI-CANCANDETECTEDCANDIRNIPUBDOCSDIRNI-CAN location (based on [NIPUBDOCSDIR])CANPUBDOCSDIRDirectory for global user-editable config filesCANVERSIONCANVERSIONNUMERICCircuit Design Suite 10.1CDS101DETECTEDCDS101DIRCircuit Design Suite 11.0CDS110DETECTEDCDS110DIRCircuit Design Suite 11.0 EduCDS110EDUDETECTEDCircuit Design Suite 11.0 ProCDS110PRODETECTEDCircuit Design Suite Core version stringCDS120COREVERSIONCircuit Design Suite Core numeric versionCDS120COREVERSIONNUMERICCircuit Design Suite 12.0CDS120DIRCircuit Design Suite 12.0 EduCDS120EDUDETECTEDCircuit Design Suite 12.0 ProCDS120PRODETECTEDCircuit Design Suite 13.0 CoreCDS130COREDETECTEDCDS130COREVERSIONCDS130COREVERSIONNUMERICCircuit Design Suite 13.0CDS130DIRCircuit Design Suite 13.0 EduCDS130EDUDETECTEDCircuit Design Suite 13.0 ProCDS130PRODETECTEDCompact RIOCOMPACTRIODETECTEDCompact RIO VersionNumericCOMPACTRIOVERSIONNUMERICCondition Monitoring Suite detectedCONDITIONMONDETECTEDCondition Monitoring SuiteCONDITIONMONDIRCompactRIO Core Installer ProductsCRIODETECTEDCRIODIRCRIOVERSIONCRIOVERSIONNUMERICCVI 2010CVI2010DETECTEDCVI2010DIRNIPUBAPPDATADIRCVI 2010 PublicAppDataCVI2010PUBAPPDATADIRDirectory for global R/W data used by appsCVI 2010 PublicDocsCVI2010PUBDOCSDIRCVI 2012CVI2012DETECTEDCVI2012DIRCVI 2012 PublicAppDataCVI2012PUBAPPDATADIRCVI 2012 PublicDocsCVI2012PUBDOCSDIRCVI 2013CVI2013DETECTEDCVI2013DIRCVI 2013 PublicAppDataCVI2013PUBAPPDATADIRCVI 2013 PublicDocsCVI2013PUBDOCSDIRCVI 4.0.0CVI400DETECTEDCVI400DIRCVI 4.0.1CVI401DETECTEDCVI401DIRCVI 5.0CVI500DETECTEDCVI500DIRCVI 5.5CVI550DETECTEDCVI550DIRCVI 6.0CVI600DETECTEDMEASUREMENTSTUDIO60DIRCVI600DIRMeasurement Studio 6.0CVI 7.0CVI700DETECTEDCVI700DIRCVI 7.1CVI710DETECTEDCVI710DIRCVI 8.0CVI800DETECTEDCVI800DIRCVI 8.1CVI810DETECTEDCVI810DIRCVI 8.5CVI850DETECTEDCVI850DIRCVI 8.5 PublicAppDataCVI850PUBAPPDATADIRCVI 8.5 PublicDocsCVI850PUBDOCSDIRCVI 9.0CVI900DETECTEDCVI900DIRCVI 9.0 PublicAppDataCVI900PUBAPPDATADIRCVI 9.0 PublicDocsCVI900PUBDOCSDIRCVI 2009CVI910DETECTEDCVI910DIRCVI 2009 PublicAppDataCVI910PUBAPPDATADIRCVI 2009 PublicDocsCVI910PUBDOCSDIRRawReadCVIVERSIONCVI Compatibility ModeCVICOMPATMODECVIDETECTEDNIDIR, NIPUBAPPDATADIR, CVIVERSIONNUMERIC, CVIDETECTED, CVIVERSIONCVI PublicAppDataCVIPUBAPPDATADIRNIDIR, NIPUBDOCSDIR, CVIVERSIONNUMERIC, CVIDETECTED, CVIVERSIONCVI PublicDocsCVIPUBDOCSDIRCVI RT 2010CVIRT2010DETECTEDCVI RT 2010 Target SupportCVIRT2010TARGSUPPORTDETECTEDCVIRT2010TARGSUPPORTVERSIONCVIRT2010TARGSUPPORTVERSIONNUMERICCVI RT 2012CVIRT2012DETECTEDCVI RT 2012 Target SupportCVIRT2012TARGSUPPORTDETECTEDCVIRT2012TARGSUPPORTVERSIONCVIRT2012TARGSUPPORTVERSIONNUMERICCVI RT 2013CVIRT2013DETECTEDCVI RT 2013 Target SupportCVIRT2013TARGSUPPORTDETECTEDCVIRT2013TARGSUPPORTVERSIONCVIRT2013TARGSUPPORTVERSIONNUMERICCVI RT 8.0CVIRT80DETECTEDCVI RT 8.0 Target SupportCVIRT80TARGSUPPORTDETECTEDCVIRT80TARGSUPPORTVERSIONCVIRT80TARGSUPPORTVERSIONNUMERICCVI RT 8.1CVIRT81DETECTEDCVI RT 8.1 Target SupportCVIRT81TARGSUPPORTDETECTEDCVIRT81TARGSUPPORTVERSIONCVIRT81TARGSUPPORTVERSIONNUMERICCVI RT 8.5CVIRT85DETECTEDCVI RT 8.5 Target SupportCVIRT85TARGSUPPORTDETECTEDCVIRT85TARGSUPPORTVERSIONCVIRT85TARGSUPPORTVERSIONNUMERICCVI RT 9.0CVIRT90DETECTEDCVI RT 9.0 Target SupportCVIRT90TARGSUPPORTDETECTEDCVIRT90TARGSUPPORTVERSIONCVIRT90TARGSUPPORTVERSIONNUMERICCVI RT 2009CVIRT91DETECTEDCVI RT 2009 Target SupportCVIRT91TARGSUPPORTDETECTEDCVIRT91TARGSUPPORTVERSIONCVIRT91TARGSUPPORTVERSIONNUMERICCVI RTCVIRTDETECTEDCVIRTTARGSUPPORTVERSIONCVI RT Target SupportCVIRTTARGSUPPORTDETECTEDCVIRTTARGSUPPORTVERSIONNUMERICCVIRTVERSIONCVIRTVERSIONNUMERICNIDIR, NISHAREDDIR, CVIVERSION, CVIVERSIONNUMERICCVI Shared DirCVISHAREDDIRCVI highest installed numericCVIVERSIONNUMERICDAQ Configuration DetectedDAQCONFIGDETECTEDDAQ Configuration Runtime VersionDAQCONFIGVERSIONNUMERICNI-DAQDAQDETECTEDDAQDIRNIDIR64Directory for 64-bit NI-DAQDAQDIR64All 64-bit NI ProductsDAQ Full DetectedDAQFULLDETECTEDDAQ Full VersionDAQFULLVERSIONNUMERICNI-DAQmx Base detectedDAQMXBASEDETECTEDInstallation directory for NI-DAQmx BaseDAQMXBASEDIRVersion for NI-DAQmx BaseDAQMXBASEVERSIONDAQ driver supportDAQMXDETECTEDDAQMXDIRDAQMXVERSIONDAQMXVERSIONNUMERICDASYLab 12.0 directoryDASYLAB120DIRDASYLab 13.0 directoryDASYLAB130DIRDASYLab 14.0 directoryDASYLAB140DIRNI DatasocketDATASOCKETDETECTEDDATASOCKETDIRDCOM9xDCOM9XDETECTEDDCOM9XVERSIONMAX Data Dictionary Schema VersionDDSVCANDDSVCTDLDDSVDAQDDSVGPIBDDSVIMAQDDSVIMAQ1394DDSVIVIDDSVMCDDSVSEDDSVVISADDSVVLDDSVVVGLDDSVVXINI-Industrial Communications for DeviceNet DetectedDEVICENETDETECTEDNI-Industrial Communications for DeviceNet VersionDEVICENETVERSIONNUMERICDataFinder Server Edition 1.0 DirectoryDFSE100DIRDataFinder Server Edition 1.1 DirectoryDFSE110DIRDataFinder Server Edition 3.0 directoryDFSE2011DIRDataFinder Server Edition 3.1 directoryDFSE2012DIRDataFinder Server Edition 3.1 directory 64-bitDFSE2012DIR64DataFinder Server Edition 3.2 directoryDFSE2013DIRDataFinder Server Edition 3.2 directory 64-bitDFSE2013DIR64DataFinder Server Edition 4.0 directoryDFSE2014DIRDataFinder Server Edition 4.0 directory 64-bitDFSE2014DIR64DataFinder Server Edition 2.0 DirectoryDFSE20DIRDataFinder Server Edition 2.1 directoryDFSE21DIRDataFinder Server Edition 2.2 directoryDFSE22DIRDIAdem 10.1DIADEM101DETECTEDDIADEM101DIRDIAdem 10.1 LanguageDIADEM101LANGDIAdem 10.1 TypeDIADEM101TYPEDIAdem 10.2 DetectedDIADEM102DETECTEDDIAdem 10.2 directoryDIADEM102DIRDIAdem 10.2 languageDIADEM102LANGDIAdem 10.2 typeDIADEM102TYPEDIAdem 10.0DIADEM10DETECTEDDIADEM10DIRDIAdem 10.0 LanguageDIADEM10LANGDIAdem 10.0 TypeDIADEM10TYPEDIADEM10VERSIONDIADEM10VERSIONNUMERICDIAdem 11.0 directoryDIADEM110DIRDIAdem 11.0 languageDIADEM110LANGDIAdem 11.0 typeDIADEM110TYPEDIAdem 11.1 directoryDIADEM111DIRDIAdem 11.2 directoryDIADEM112DIRDIAdem 11.3 directoryDIADEM2011DIRDIAdem 12.0 directoryDIADEM2012DIRDIAdem 13.0 directoryDIADEM2013DIRDIAdem 13.0 directory 64-bitDIADEM2013DIR64DIAdem 14.0 directoryDIADEM2014DIRDIAdem 14.0 directory 64-bitDIADEM2014DIR64DIADEMVERSIONDIAdem (highest installed VersionString)DIADEMDETECTEDNIDIR, DIADEMVERSIONDIADEMDIRDIAdem Language (highest version)DIADEMLANGDIAdem Type (highest version)DIADEMTYPEDIADEMVERSIONNUMERICDigital Modulation Toolkit - CVI SupportDMTCVIDETECTEDDMTCVIDIRDMTCVIVERSIONDMTCVIVERSIONNUMERICModulation ToolkitDMTDETECTEDDMTDIRDigital Modulation Toolkit - LabVIEWDMTLVDETECTEDDigital Modulation Toolkit - LabVIEW SupportDMTLVDIRDMTLVVERSIONDMTLVVERSIONNUMERICNI-DNETDNETDETECTEDDNETDIRNI-DNET location (based on [NIPUBDOCSDIR])DNETPUBDOCSDIRDNETVERSIONDNETVERSIONNUMERICNI-Industrial Communications for DNP3DNP3DETECTEDNI-Industrial Communications for DNP3 Version NumericDNP3VERSIONNUMERIC.Net Framework 1.0DOTNET10DETECTED.Net Framework 1.1DOTNET11DETECTED.NET Framework 1.1 SP valueDOTNET11SP.Net Framework 2.0DOTNET20DETECTED.NET Framework 3.0DOTNET30DETECTED.Net Framework 3.5DOTNET35DETECTED.Net Framework 4.0DOTNET40DETECTED.Net Framework 4.5DOTNET45DETECTED.Net FrameworkDOTNETDETECTEDDOTNETDIRPrivateDOTNETDIR.Net Framework 64-bitDOTNETDIR64Latest .NET Framework Version InstalledDOTNETMAXVERSIONNUMERICNIPALSHAREDDIRDriver Signing Staging DirectoryDRIVERSIGNSTAGINGDIRNISHAREDDIRNI-PAL Shared DirectoryEnterprise DataFinder DirectoryEDFDIRNI ELVISELVISDETECTEDNI ELVISmxELVISMXDIRNI ELVIS ( highest installed VersionString)ELVISVERSIONNUMERICEmbedded Visual C 4.0EMBVC40DETECTEDLEGODIRLEGO EV3 EDU 1.0 DirectoryEV3EDU1DIRDirectory for all LEGO productsLEGO EV3 Retail 1.0 DirectoryEV3RETAIL1DIRFIELDPOINTVERSIONPrivateFieldPointFIELDPOINTDETECTEDNIDIR, FIELDPOINTVERSIONPrivateFIELDPOINTDIRFIELDPOINTVERSIONFIELDPOINTVERSIONNUMERICFIREFOXVERSIONFirefoxFIREFOXDETECTEDFIREFOXDIRFirefox PluginsFIREFOXPLUGINSDIRNI FlexMotionFLEXMOTIONDETECTEDNIMCDIRFLEXMOTIONDIRNI MotionFLEXMOTIONVERSIONFLEXMOTIONVERSIONNUMERICFlexRIO Core Installer ProductsFLEXRIODIRLabVIEW FPGA 2010 DetectedFPGA2010DETECTEDLabVIEW FPGA 2010 LanguageFPGA2010LANGLabVIEW FPGA 2011 DetectedFPGA2011DETECTEDLabVIEW FPGA 2011 LanguageFPGA2011LANGLabVIEW FPGA 2012 DetectedFPGA2012DETECTEDLabVIEW FPGA 2012 LanguageFPGA2012LANGLabVIEW FPGA 2013 DetectedFPGA2013DETECTEDLabVIEW FPGA 2013 LanguageFPGA2013LANGLabVIEW FPGA 2014 DetectedFPGA2014DETECTEDLabVIEW FPGA 2014 LanguageFPGA2014LANGLabVIEW FPGA 7.0FPGA70DETECTEDLabVIEW FPGA 7.1FPGA71DETECTEDLabVIEW FPGA 8.0FPGA80DETECTEDFPGA 8.2 DetectedFPGA82DETECTEDFPGA 8.5 DetectedFPGA85DETECTEDFPGA 8.6 DetectedFPGA86DETECTEDLabVIEW FPGA 2009 module detectionFPGA90DETECTEDLabVIEW FPGAFPGADETECTEDFPGAVERSION, LVDIR, LVVERSIONLabVIEW Directory where LabVIEW FPGA is installedFPGALVDIRFPGAVERSIONFPGAVERSIONNUMERICNI Requirements Gateway 1.0GATEWAY100DIRNI Requirements Gateway 1.1GATEWAY110DETECTEDGATEWAY110DIRNI Requirements Gateway 1.2GATEWAY2012DETECTEDGATEWAY2012DIRGPIB-488GPIB488DETECTEDMain install path for GPIB-488 softwareGPIB488DIRIVI Compliance PackageICPDETECTEDICPVERSIONICPVERSIONNUMERICIVI Driver Toolset 2.0IDT20DETECTEDIDT20VERSIONIDT20VERSIONNUMERICIVI Driver ToolsetIDTDETECTEDIDTVERSIONIDTVERSIONNUMERICNI-Industrial Communications for IEC 61850IEC61850DETECTEDNI-Industrial Communications for IEC 61850 Version NumericIEC61850VERSIONNUMERICInternet ExplorerIEDETECTEDIEDIRInternet Explorer PluginsIEPLUGINSDETECTEDIEPLUGINSDIRIEVERSIONInternetExplorerIEVERSIONNUMERICNI InterfacesINTERFACESDETECTEDINTERFACESDIRUsed for IOtech Software installersIOTDIRNI I/O Trace DirectoryIOTRACEDIRIMAQ Vision Builder 6.0IVB60DETECTEDIVB60DIRIMAQ Vision Builder 6.0 JIVB60JDETECTEDIVB60JDIRIMAQ Vision Builder 6.1IVB61DETECTEDIVB61DIRIVBVERSIONIMAQ Vision BuilderIVBDETECTEDNIDIR, IVBVERSIONIVBDIRIVBVERSIONNUMERICIVI Engine PackageIVIENGINEPACKAGEDETECTEDIVIENGINEPACKAGEVERSIONIVIENGINEPACKAGEVERSIONNUMERICIVI Foundation dir (dummy prop only to define child props)IVIFOUNDATIONDIRIVI Foundation 64-bit dir (dummy prop only to define child props)IVIFOUNDATIONDIR64IVI VISA COM detected propertyIVIVISACOMDETECTEDIVI VISA COM version propertyIVIVISACOMVERSIONIVI VISA COM version numeric propertyIVIVISACOMVERSIONNUMERICLATESTMSVBPARENTDIRLatest MS VB DirLATESTMSVBDIRRequired for LATESTMSVBDIRMS Visual BasicLATESTMSVBVERSIONLookout Free Client 5.1LKCLIENT51DETECTEDLookout Free Client 6.0LKCLIENT60DETECTEDLookout Free Client 6.1LKCLIENT61DETECTEDLookout Free Client 6.2LKCLIENT62DETECTEDLookout Free Client 6.5LKCLIENT65DETECTEDLookout Free Client 6.6LKCLIENT66DETECTEDLookout Free Client 6.7LKCLIENT67DETECTEDLookout 5.0LKCLIENTDETECTEDLookout Regular 5.1LKDEV51DETECTEDLookout Regular 6.0LKDEV60DETECTEDLookout Regular 6.1LKDEV61DETECTEDLookout Regular 6.2LKDEV62DETECTEDLookout Regular 6.5LKDEV65DETECTEDLookout Regular 6.6LKDEV66DETECTEDLookout Regular 6.7LKDEV67DETECTEDLKDEVDETECTEDLookout Web Player 5.1LKPLAYER51DETECTEDLookout Web Player 6.0LKPLAYER60DETECTEDLookout Web Player 6.1LKPLAYER61DETECTEDLookout Web Player 6.2LKPLAYER62DETECTEDLookout Web Player 6.5LKPLAYER65DETECTEDLookout Web Player 6.6LKPLAYER66DETECTEDLookout Web Player 6.7LKPLAYER67DETECTEDLKPLAYERDETECTEDLogos 4.0LOGOS40DETECTEDLOGOS40DIRAll NI Shared components LOGOSVERSIONLogosLOGOSDETECTEDNISHAREDDIR, LOGOSVERSIONLOGOSDIRNISHAREDDIR64, LOGOSVERSIONLogos 64-bitLOGOSDIR64Lookout 4.0LOOKOUT40DETECTEDLOOKOUT40DIRLOOKOUT50DIRLookout 5.1LOOKOUT51DIRLookout 6.0LOOKOUT60DIRLookout 6.1LOOKOUT61DIRLookout 6.2LOOKOUT62DIRLookout 6.5LOOKOUT65DIRLookout 6.6LOOKOUT66DIRLookout 6.7LOOKOUT67DIRLabVIEW 10.0 DetectedLV2010DETECTEDLabVIEW 10.0 Detected 64-bitLV2010DETECTED64LabVIEW 10.0 DirectoryLV2010DIRLabVIEW 10.0 Directory 64-bitLV2010DIR64LabVIEW 10.0 ExamplesDirLV2010EXAMPLESDIRLabVIEW 10.0 ExamplesDir 64-bitLV2010EXAMPLESDIR64LabVIEW 10.0 FF RTE DetectedLV2010FFRTEDETECTEDLabVIEW 10.0 FF RTE Detected 64-bitLV2010FFRTEDETECTED64LabVIEW 10.0 FF RTE DirectoryLV2010FFRTEDIRLVRTEDIR64LabVIEW 10.0 FF RTE Directory 64-bitLV2010FFRTEDIR64NISHAREDDIR64LabVIEW 10.0 HelpDirLV2010HELPDIRLabVIEW 10.0 HelpDir 64-bitLV2010HELPDIR64LabVIEW 10.0 InstrLibDirLV2010INSTRLIBDIRLabVIEW 10.0 InstrLibDir 64-bitLV2010INSTRLIBDIR64LabVIEW 10.0 LanguageLV2010LANGLabVIEW 10.0 Language 64-bitLV2010LANG64LabVIEW 10.0 PaletteDirLV2010PALETTESDIRLabVIEW 10.0 PaletteDir 64-bitLV2010PALETTESDIR64LabVIEW 10.0 PluginsDirLV2010PLUGINSDIRLabVIEW 10.0 PluginsDir 64-bitLV2010PLUGINSDIR64LV2010 project dummy directoryLV2010PROJECTDUMMYDIRLV2010 project dummy directory 64 bitLV2010PROJECTDUMMYDIR64LabVIEW 10.0 PubDocsDirLV2010PUBDOCSDIRLabVIEW 10.0 PubDocsDir 64-bitLV2010PUBDOCSDIR64LabVIEW 10.0 PubInstrLibDirLV2010PUBINSTRLIBDIRLabVIEW 10.0 PubInstrLibDir 64-bitLV2010PUBINSTRLIBDIR64LabVIEW 2010 RoboticsLV2010ROBODETECTEDLabVIEW 10.0 RTE DetectedLV2010RTEDETECTEDLabVIEW 10.0 RTE Detected 64-bitLV2010RTEDETECTED64LabVIEW 10.0 RTE DirectoryLV2010RTEDIRLabVIEW 10.0 RTE Directory 64-bitLV2010RTEDIR64LabVIEW 10.0 TemplatesDirLV2010TEMPLATESDIRLabVIEW 10.0 TemplatesDir 64-bitLV2010TEMPLATESDIR64LabVIEW 10.0 ToolKitErrorsDirLV2010TOOLKITERRORSDIRLabVIEW 10.0 ToolKitErrorsDir 64-bitLV2010TOOLKITERRORSDIR64LabVIEW 10.0 ToolsDirLV2010TOOLSDIRLabVIEW 10.0 ToolsDir 64-bitLV2010TOOLSDIR64LabVIEW 10.0 TypeLV2010TYPELabVIEW 10.0 Type 64-bitLV2010TYPE64LabVIEW 10.0 VersionLV2010VERSIONLabVIEW 10.0 Version 64-bitLV2010VERSION64LabVIEW 10.0 Version NumericLV2010VERSIONNUMERICLabVIEW 10.0 Version Numeric 64-bitLV2010VERSIONNUMERIC64LabVIEW 11.0 DetectedLV2011DETECTEDLabVIEW 11.0 Detected 64-bitLV2011DETECTED64LabVIEW 11.0 DirectoryLV2011DIRLabVIEW 11.0 Directory 64-bitLV2011DIR64LabVIEW 11.0 ExamplesDirLV2011EXAMPLESDIRLabVIEW 11.0 ExamplesDir 64-bitLV2011EXAMPLESDIR64LabVIEW 11.0 FF RTE DetectedLV2011FFRTEDETECTEDLabVIEW 11.0 FF RTE Detected 64-bitLV2011FFRTEDETECTED64LabVIEW 11.0 FF RTE DirectoryLV2011FFRTEDIRLabVIEW 11.0 FF RTE Directory 64-bitLV2011FFRTEDIR64LabVIEW 11.0 HelpDirLV2011HELPDIRLabVIEW 11.0 HelpDir 64-bitLV2011HELPDIR64LabVIEW 11.0 InstrLibDirLV2011INSTRLIBDIRLabVIEW 11.0 InstrLibDir 64-bitLV2011INSTRLIBDIR64LabVIEW 11.0 LanguageLV2011LANGLabVIEW 11.0 Language 64-bitLV2011LANG64LabVIEW 11.0 PaletteDirLV2011PALETTESDIRLabVIEW 11.0 PaletteDir 64-bitLV2011PALETTESDIR64The dev phase of LV 2011. May be Dev, Alpha, Beta, RC, ReleaseLV2011PHASELV2011PHASE64LabVIEW 11.0 PluginsDirLV2011PLUGINSDIRLabVIEW 11.0 PluginsDir 64-bitLV2011PLUGINSDIR64LV2011 project dummy directoryLV2011PROJECTDUMMYDIRLV2011 project dummy directory 64 bitLV2011PROJECTDUMMYDIR64LabVIEW 11.0 PubDocsDirLV2011PUBDOCSDIRLabVIEW 11.0 PubDocsDir 64-bitLV2011PUBDOCSDIR64LabVIEW 11.0 PubInstrLibDirLV2011PUBINSTRLIBDIRLabVIEW 11.0 PubInstrLibDir 64-bitLV2011PUBINSTRLIBDIR64LabVIEW 2011 RoboticsLV2011ROBODETECTEDLabVIEW 11.0 RTE DetectedLV2011RTEDETECTEDLabVIEW 11.0 RTE Detected 64-bitLV2011RTEDETECTED64LabVIEW 11.0 RTE DirectoryLV2011RTEDIRLabVIEW 11.0 RTE Directory 64-bitLV2011RTEDIR64LabVIEW 11.0 TemplatesDirLV2011TEMPLATESDIRLabVIEW 11.0 TemplatesDir 64-bitLV2011TEMPLATESDIR64LabVIEW 11.0 ToolKitErrorsDirLV2011TOOLKITERRORSDIRLabVIEW 11.0 ToolKitErrorsDir 64-bitLV2011TOOLKITERRORSDIR64LabVIEW 11.0 ToolsDirLV2011TOOLSDIRLabVIEW 11.0 ToolsDir 64-bitLV2011TOOLSDIR64LabVIEW 11.0 TypeLV2011TYPELabVIEW 11.0 Type 64-bitLV2011TYPE64LabVIEW 11.0 VersionLV2011VERSIONLabVIEW 11.0 Version 64-bitLV2011VERSION64LabVIEW 11.0 Version NumericLV2011VERSIONNUMERICLabVIEW 11.0 Version Numeric 64-bitLV2011VERSIONNUMERIC64LabVIEW 12.0 DetectedLV2012DETECTEDLabVIEW 12.0 Detected 64-bitLV2012DETECTED64LabVIEW 12.0 DirectoryLV2012DIRLabVIEW 12.0 Directory 64-bitLV2012DIR64LabVIEW 12.0 ExamplesDirLV2012EXAMPLESDIRLabVIEW 12.0 ExamplesDir 64-bitLV2012EXAMPLESDIR64LabVIEW 12.0 FF RTE DetectedLV2012FFRTEDETECTEDLabVIEW 12.0 FF RTE Detected 64-bitLV2012FFRTEDETECTED64LabVIEW 12.0 FF RTE DirectoryLV2012FFRTEDIRLabVIEW 12.0 FF RTE Directory 64-bitLV2012FFRTEDIR64LabVIEW 12.0 HelpDirLV2012HELPDIRLabVIEW 12.0 HelpDir 64-bitLV2012HELPDIR64LabVIEW 12.0 InstrLibDirLV2012INSTRLIBDIRLabVIEW 12.0 InstrLibDir 64-bitLV2012INSTRLIBDIR64LabVIEW 12.0 LanguageLV2012LANGLabVIEW 12.0 Language 64-bitLV2012LANG64LabVIEW 12.0 PaletteDirLV2012PALETTESDIRLabVIEW 12.0 PaletteDir 64-bitLV2012PALETTESDIR64The dev phase of LV 2012. May be Dev, Alpha, Beta, RC, ReleaseLV2012PHASELV2012PHASE64LabVIEW 12.0 PluginsDirLV2012PLUGINSDIRLabVIEW 12.0 PluginsDir 64-bitLV2012PLUGINSDIR64LV2012 project dummy directoryLV2012PROJECTDUMMYDIRLV2012 project dummy directory 64 bitLV2012PROJECTDUMMYDIR64LabVIEW 12.0 PubDocsDirLV2012PUBDOCSDIRLabVIEW 12.0 PubDocsDir 64-bitLV2012PUBDOCSDIR64LabVIEW 12.0 PubInstrLibDirLV2012PUBINSTRLIBDIRLabVIEW 12.0 PubInstrLibDir 64-bitLV2012PUBINSTRLIBDIR64LabVIEW 2012 Robotics Module Installer ProductsLV2012ROBODETECTEDLabVIEW 12.0 RTE DetectedLV2012RTEDETECTEDLabVIEW 12.0 RTE Detected 64-bitLV2012RTEDETECTED64LabVIEW 12.0 RTE DirectoryLV2012RTEDIRLabVIEW 12.0 RTE Directory 64-bitLV2012RTEDIR64LabVIEW 12.0 TemplatesDirLV2012TEMPLATESDIRLabVIEW 12.0 TemplatesDir 64-bitLV2012TEMPLATESDIR64LabVIEW 12.0 ToolKitErrorsDirLV2012TOOLKITERRORSDIRLabVIEW 12.0 ToolKitErrorsDir 64-bitLV2012TOOLKITERRORSDIR64LabVIEW 12.0 ToolsDirLV2012TOOLSDIRLabVIEW 12.0 ToolsDir 64-bitLV2012TOOLSDIR64LabVIEW 12.0 TypeLV2012TYPELabVIEW 12.0 Type 64-bitLV2012TYPE64LabVIEW 12.0 VersionLV2012VERSIONLabVIEW 12.0 Version 64-bitLV2012VERSION64LabVIEW 12.0 Version NumericLV2012VERSIONNUMERICLabVIEW 12.0 Version Numeric 64-bitLV2012VERSIONNUMERIC64LabVIEW 13.0 DetectedLV2013DETECTEDLabVIEW 13.0 Detected 64-bitLV2013DETECTED64LabVIEW 13.0 DirectoryLV2013DIRLabVIEW 13.0 Directory 64-bitLV2013DIR64LabVIEW 13.0 ExamplesDirLV2013EXAMPLESDIRLabVIEW 13.0 ExamplesDir 64-bitLV2013EXAMPLESDIR64LabVIEW 13.0 FF RTE DetectedLV2013FFRTEDETECTEDLabVIEW 13.0 FF RTE Detected 64-bitLV2013FFRTEDETECTED64LabVIEW 13.0 FF RTE DirectoryLV2013FFRTEDIRLabVIEW 13.0 FF RTE Directory 64-bitLV2013FFRTEDIR64LabVIEW 13.0 HelpDirLV2013HELPDIRLabVIEW 13.0 HelpDir 64-bitLV2013HELPDIR64LabVIEW 13.0 InstrLibDirLV2013INSTRLIBDIRLabVIEW 13.0 InstrLibDir 64-bitLV2013INSTRLIBDIR64LabVIEW 13.0 LanguageLV2013LANGLabVIEW 13.0 Language 64-bitLV2013LANG64LabVIEW 13.0 PaletteDirLV2013PALETTESDIRLabVIEW 13.0 PaletteDir 64-bitLV2013PALETTESDIR64The dev phase of LV 2013. May be Dev, Alpha, Beta, RC, ReleaseLV2013PHASELV2013PHASE64LabVIEW 13.0 PluginsDirLV2013PLUGINSDIRLabVIEW 13.0 PluginsDir 64-bitLV2013PLUGINSDIR64LV2013 project dummy directoryLV2013PROJECTDUMMYDIRLV2013 project dummy directory 64 bitLV2013PROJECTDUMMYDIR64LabVIEW 13.0 PubDocsDirLV2013PUBDOCSDIRLabVIEW 13.0 PubDocsDir 64-bitLV2013PUBDOCSDIR64LabVIEW 13.0 PubInstrLibDirLV2013PUBINSTRLIBDIRLabVIEW 13.0 PubInstrLibDir 64-bitLV2013PUBINSTRLIBDIR64LabVIEW 2013 Robotics Module Installer ProductsLV2013ROBODETECTEDLabVIEW 13.0 RTE DetectedLV2013RTEDETECTEDLabVIEW 13.0 RTE Detected 64-bitLV2013RTEDETECTED64LabVIEW 13.0 RTE DirectoryLabVIEW 13.0 RTE Directory 64-bitLV2013RTEDIR64LabVIEW 13.0 TemplatesDirLV2013TEMPLATESDIRLabVIEW 13.0 TemplatesDir 64-bitLV2013TEMPLATESDIR64LabVIEW 13.0 ToolKitErrorsDirLV2013TOOLKITERRORSDIRLabVIEW 13.0 ToolKitErrorsDir 64-bitLV2013TOOLKITERRORSDIR64LabVIEW 13.0 ToolsDirLV2013TOOLSDIRLabVIEW 13.0 ToolsDir 64-bitLV2013TOOLSDIR64LabVIEW 13.0 TypeLV2013TYPELabVIEW 13.0 Type 64-bitLV2013TYPE64LabVIEW 13.0 VersionLV2013VERSIONLabVIEW 13.0 Version 64-bitLV2013VERSION64LabVIEW 13.0 Version NumericLV2013VERSIONNUMERICLabVIEW 13.0 Version Numeric 64-bitLV2013VERSIONNUMERIC64LabVIEW 14.0 DetectedLV2014DETECTEDLabVIEW 14.0 Detected 64-bitLV2014DETECTED64LabVIEW 14.0 DirectoryLV2014DIRLabVIEW 14.0 Directory 64-bitLV2014DIR64LabVIEW 14.0 ExamplesDirLV2014EXAMPLESDIRLabVIEW 14.0 ExamplesDir 64-bitLV2014EXAMPLESDIR64LabVIEW 14.0 FF RTE DetectedLV2014FFRTEDETECTEDLabVIEW 14.0 FF RTE Detected 64-bitLV2014FFRTEDETECTED64LabVIEW 14.0 FF RTE DirectoryLV2014FFRTEDIRLabVIEW 14.0 FF RTE Directory 64-bitLV2014FFRTEDIR64LabVIEW 14.0 HelpDirLV2014HELPDIRLabVIEW 14.0 HelpDir 64-bitLV2014HELPDIR64LabVIEW 14.0 InstrLibDirLV2014INSTRLIBDIRLabVIEW 14.0 InstrLibDir 64-bitLV2014INSTRLIBDIR64LabVIEW 14.0 LanguageLV2014LANGLabVIEW 14.0 Language 64-bitLV2014LANG64LabVIEW 14.0 PaletteDirLV2014PALETTESDIRLabVIEW 14.0 PaletteDir 64-bitLV2014PALETTESDIR64The dev phase of LV 2014. May be Dev, Alpha, Beta, RC, ReleaseLV2014PHASELV2014PHASE64LabVIEW 14.0 PluginsDirLV2014PLUGINSDIRLabVIEW 14.0 PluginsDir 64-bitLV2014PLUGINSDIR64LV2014 project dummy directoryLV2014PROJECTDUMMYDIRLV2014 project dummy directory 64 bitLV2014PROJECTDUMMYDIR64LabVIEW 14.0 PubDocsDirLV2014PUBDOCSDIRLabVIEW 14.0 PubDocsDir 64-bitLV2014PUBDOCSDIR64LabVIEW 14.0 PubInstrLibDirLV2014PUBINSTRLIBDIRLabVIEW 14.0 PubInstrLibDir 64-bitLV2014PUBINSTRLIBDIR64LabVIEW 2014 Robotics Module Installer ProductsLV2014ROBODETECTEDLabVIEW 14.0 RTE DetectedLV2014RTEDETECTEDLabVIEW 14.0 RTE Detected 64-bitLV2014RTEDETECTED64LabVIEW 14.0 RTE DirectoryLV2014RTEDIRLabVIEW 14.0 RTE Directory 64-bitLV2014RTEDIR64LabVIEW 14.0 TemplatesDirLV2014TEMPLATESDIRLabVIEW 14.0 TemplatesDir 64-bitLV2014TEMPLATESDIR64LabVIEW 14.0 ToolKitErrorsDirLV2014TOOLKITERRORSDIRLabVIEW 14.0 ToolKitErrorsDir 64-bitLV2014TOOLKITERRORSDIR64LabVIEW 14.0 ToolsDirLV2014TOOLSDIRLabVIEW 14.0 ToolsDir 64-bitLV2014TOOLSDIR64LabVIEW 14.0 TypeLV2014TYPELabVIEW 14.0 Type 64-bitLV2014TYPE64LabVIEW 14.0 VersionLV2014VERSIONLabVIEW 14.0 Version 64-bitLV2014VERSION64LabVIEW 14.0 Version NumericLV2014VERSIONNUMERICLabVIEW 14.0 Version Numeric 64-bitLV2014VERSIONNUMERIC64LabVIEW 5.0.1LV501DETECTEDLV501DIRLabVIEW 5.0LV50DETECTEDLV50DIRLabVIEW 5.1.xLV51DETECTEDLV51DIRLV5DETECTEDLV5DIRLabVIEW 6.0LV60DETECTEDLV60DIRLabVIEW 6.0 LanguageLV60LANGLabVIEW 6.0 Type (Pro, Full, Base)LV60TYPELV60VERSIONLV60VERSIONNUMERICLabVIEW 6.1LV61DETECTEDLV61DIRLabVIEW 6.1 LanguageLV61LANGLabVIEW 6.1 Runtime EngineLV61RTEDETECTEDLV61RTEDIRLabVIEW 6.1 Type (Pro, Full, Base)LV61TYPELV61VERSIONLV61VERSIONNUMERICLabVIEW 7.0LV70DETECTEDLV70DIRLabVIEW 7.0 LanguageLV70LANGLabVIEW 7.0 Runtime EngineLV70RTEDETECTEDLV70RTEDIRLabVIEW 7.0 Type (Pro, Full, Base)LV70TYPELabVIEW 7.1LV71DETECTEDLV71DIRLabVIEW 7.1 Embedded DSPLV71DSPDETECTEDLV71DSPDIRLV71DSPVERSIONLV71DSPVERSIONNUMERICLabVIEW 7.1 EmbeddedLV71EMBDETECTEDLV71EMBDIRLV71EMBVERSIONLV71EMBVERSIONNUMERICLabVIEW 7.1 LanguageLV71LANGLabVIEW 7.1 Runtime EngineLV71RTEDETECTEDLV71RTEDIRLabVIEW 7.1 Type (Pro, Full, Base)LV71TYPELV71VERSIONLV71VERSIONNUMERICLV7VERSIONLV7VERSIONNUMERICLabVIEW 8.0LV80DETECTEDLV80DIRLabVIEW 8.0 FF RuntimeLV80FFRTEDETECTEDLV80FFRTEDIRLabVIEW 8.0 LanguageLV80LANGLabVIEW 8.0 Runtime EngineLV80RTEDETECTEDLV80RTEDIRLabVIEW 8.0 Type (Pro, Full, Base)LV80TYPELV80VERSIONLV80VERSIONNUMERICLabVIEW 8.2LV82DETECTEDLV82DIRLabVIEW 8.2 FF RuntimeLV82FFRTEDETECTEDLV82FFRTEDIRLabVIEW 8.2 LanguageLV82LANGLabVIEW 8.2 Runtime EngineLV82RTEDETECTEDLV82RTEDIRLabVIEW 8.2 Type (Pro, Full, Base)LV82TYPELV82VERSIONLV82VERSIONNUMERICLabVIEW 8.5LV85DETECTEDLV85DIRLabVIEW 8.5 FF RuntimeLV85FFRTEDETECTEDLV85FFRTEDIRLabVIEW 8.5 LanguageLV85LANGLabVIEW 8.5 Runtime EngineLV85RTEDETECTEDLV85RTEDIRLabVIEW 8.5 Type (Pro, Full, Base)LV85TYPELV85VERSIONLV85VERSIONNUMERICLabVIEW 8.6 DetectedLV86DETECTEDLV86DETECTED64LabVIEW 8.6 DirLV86DIRLV86DIR64LabVIEW 8.6 ExamplesDirLV86EXAMPLESDIRLV86EXAMPLESDIR64LabVIEW 8.6 FF RTE DetectedLV86FFRTEDETECTEDLV86FFRTEDETECTED64LabVIEW 8.6 FF RTE DirLV86FFRTEDIRLV86FFRTEDIR64LabVIEW 8.6 HelpDirLV86HELPDIRLV86HELPDIR64LabVIEW 8.6 InstrLibDirLV86INSTRLIBDIRLV86INSTRLIBDIR64LabVIEW 8.6 LanguageLV86LANGLV86LANG64LabVIEW 8.6 PaletteDirLV86PALETTESDIRLV86PALETTESDIR64LabVIEW 8.6 PluginsDirLV86PLUGINSDIRLV86PLUGINSDIR64Dummy Dir for LV86TOOLKITERRORSDIRLV86PROJECTDUMMYDIRLV86PROJECTDUMMYDIR64LabVIEW 8.6 PubDocsDirLV86PUBDOCSDIRLV86PUBDOCSDIR64LabVIEW 8.6 PubInstrLibDirLV86PUBINSTRLIBDIRLV86PUBINSTRLIBDIR64LabVIEW 8.6 RTE DetectedLV86RTEDETECTEDLV86RTEDETECTED64LabVIEW 8.6 RTE DirLV86RTEDIRLV86RTEDIR64LabVIEW 8.6 TemplatesDirLV86TEMPLATESDIRLV86TEMPLATESDIR64LabVIEW 8.6 ToolKitErrorsDirLV86TOOLKITERRORSDIRLV86TOOLKITERRORSDIR64LabVIEW 8.6 ToolsDirLV86TOOLSDIRLV86TOOLSDIR64LabVIEW 8.6 TypeLV86TYPELV86TYPE64LabVIEW 8.6 VersionLV86VERSIONLV86VERSION64LabVIEW 8.6 Version NumericLV86VERSIONNUMERICLV86VERSIONNUMERIC64LabVIEW 9.0 DetectedLV90DETECTEDLabVIEW 9.0 Detected 64-bitLV90DETECTED64LabVIEW 9.0 DirectoryLV90DIRLabVIEW 9.0 Directory 64-bitLV90DIR64LabVIEW 9.0 ExamplesDirLV90EXAMPLESDIRLabVIEW 9.0 ExamplesDir 64-bitLV90EXAMPLESDIR64LabVIEW 9.0 FF RTE DetectedLV90FFRTEDETECTEDLabVIEW 9.0 FF RTE Detected 64-bitLV90FFRTEDETECTED64LabVIEW 9.0 FF RTE DirectoryLV90FFRTEDIRLabVIEW 9.0 FF RTE Directory 64-bitLV90FFRTEDIR64LabVIEW 9.0 HelpDirLV90HELPDIRLabVIEW 9.0 HelpDir 64-bitLV90HELPDIR64LabVIEW 9.0 InstrLibDirLV90INSTRLIBDIRLabVIEW 9.0 InstrLibDir 64-bitLV90INSTRLIBDIR64LabVIEW 9.0 LanguageLV90LANGLabVIEW 9.0 Language 64-bitLV90LANG64LabVIEW 9.0 PaletteDirLV90PALETTESDIRLabVIEW 9.0 PaletteDir 64-bitLV90PALETTESDIR64LabVIEW 9.0 PluginsDirLV90PLUGINSDIRLabVIEW 9.0 PluginsDir 64-bitLV90PLUGINSDIR64LabVIEW 9.0 PubDocsDirLV90PUBDOCSDIRLabVIEW 9.0 PubDocsDir 64-bitLV90PUBDOCSDIR64LabVIEW 9.0 PubInstrLibDirLV90PUBINSTRLIBDIRLabVIEW 9.0 PubInstrLibDir 64-bitLV90PUBINSTRLIBDIR64LV90 Robotics DetectedLV90ROBODETECTEDLabVIEW 9.0 RTE DetectedLV90RTEDETECTEDLabVIEW 9.0 RTE Detected 64-bitLV90RTEDETECTED64LabVIEW 9.0 RTE DirectoryLV90RTEDIRLabVIEW 9.0 RTE Directory 64-bitLV90RTEDIR64LabVIEW 9.0 TemplatesDirLV90TEMPLATESDIRLabVIEW 9.0 TemplatesDir 64-bitLV90TEMPLATESDIR64LabVIEW 9.0 ToolKitErrorsDirLV90TOOLKITERRORSDIRLabVIEW 9.0 ToolKitErrorsDir 64-bitLV90TOOLKITERRORSDIR64LabVIEW 9.0 ToolsDirLV90TOOLSDIRLabVIEW 9.0 ToolsDir 64-bitLV90TOOLSDIR64LabVIEW 9.0 TypeLV90TYPELabVIEW 9.0 Type 64-bitLV90TYPE64LabVIEW 9.0 VersionLV90VERSIONLabVIEW 9.0 Version 64-bitLV90VERSION64LabVIEW 9.0 Version NumericLV90VERSIONNUMERICLabVIEW 9.0 Version Numeric 64-bitLV90VERSIONNUMERIC64NI LV BrokerLVBROKERDETECTEDLVBROKERDETECTED64LVBROKERDIRLVBROKERDIR64All 64-bit NI Shared components LVVERSIONLVDETECTEDLabVIEW (higest installed VersionString)LVVERSION64LVDETECTED64NIDIR64, LVVERSION64LVDIR64LabVIEW DSC RTSLVDSCRTSDETECTEDLVDSCRTSDIRLVDSCRTSVERSIONLVDSCRTSVERSIONNUMERICLVDIR, LVPUBDOCSDIR, LVVERSION, LVDETECTED, LVVERSIONNUMERICLV examples for most NI productsLVEXAMPLESDIRLabVIEW FF Runtime (highest installed VersionString)LVFFRTEDETECTEDLVFFRTEDETECTED64LVFFRTEVERSIONLVFFRTEDIRLVRTEDIR64, LVFFRTEVERSION64LVFFRTEDIR64LVFFRTEVERSION64LVFFRTEVERSIONNUMERICLVFFRTEVERSIONNUMERIC64LVDIR, LVVERSION, LVDETECTED, LVVERSIONNUMERICLV help files for most NI productsLVHELPDIRNI modular instruments LV VIsLVINSTRLIBDIRNI LabVIEWLVLANGLVLANG64LVMobile version stringLVMOBILEVERSIONLVMobile version numericLVMOBILEVERSIONNUMERICLV menu palettes for most NI productsLVPALETTESDIRDummy dir to define the parent dir of LVTOOLSDIRLVPLUGINSDIRLabVIEW 2010 Windows Mobile ModuleLVPPC2010DETECTEDLabVIEW 2012 Windows Mobile ModuleLVPPC2012DETECTEDLabVIEW PDA for Pocket PC 7.0LVPPC70DETECTEDLabVIEW PDA for Pocket PC 7.1LVPPC71DETECTEDLabVIEW PDA for Pocket PC 8.0LVPPC80DETECTEDLabVIEW PDA for Pocket PC 8.2LVPPC82DETECTEDLabVIEW PDA for Pocket PC 8.5LVPPC85DETECTEDLabVIEW 8.6 Windows Mobile ModuleLVPPC86DETECTEDLabVIEW 2009 Windows Mobile ModuleLVPPC90DETECTEDLabVIEW PDA for Pocket PCLVPPCDETECTEDLVPPCVERSIONLVPPCVERSIONNUMERICLVDIR, NIPUBDOCSDIR, LVVERSION, LVDETECTED, LVVERSIONNUMERICLV root dir for "all users" filesLVPUBDOCSDIR3rd party LV instr driversLVPUBINSTRLIBDIRLVROBOVERSIONLV Robotics Module (highest installed VersionString)LVROBODETECTEDLV Robotics Module (higest installed VersionString)LabVIEW Run-Time EngineLVRTEVERSIONLVRTEVERSION64LVRTEVERSIONNUMERICLVRTEVERSIONNUMERIC64LVDIR, LVPLUGINSDIR, LVVERSION, LVDETECTED, LVVERSIONNUMERICLV template VIs for NI productsLVTEMPLATESDIRLVDIR, LVTOOLSDIR, LVVERSIONLV Toolkit Error DirLVTOOLKITERRORSDIRThe old LV "projects" directoryLVTOOLSDIRLabVIEW 2010 Touch Panel ModuleLVTP2010DETECTEDLabVIEW 2012 Touch Panel ModuleLVTP2012DETECTEDLabVIEW 8.2 Touch Panel Module for Windows CELVTP82DETECTEDLabview 8.5 Touch Panel Module for Windows CELVTP85DETECTEDLabVIEW 8.6 Touch Panel ModuleLVTP86DETECTEDLabVIEW 2009 Touch Panel ModuleLVTP90DETECTEDLabVIEW Type (Pro, Full, Base)LVTYPELVTYPE64LVVERSIONNUMERICLVVERSIONNUMERIC64MATLAB 6.1MATLAB61DETECTEDMATLAB61DIRMATLAB 6.5MATLAB65DETECTEDMATLAB65DIRMATLAB 6.0MATLAB6DETECTEDMATLAB6DIRMATLABVERSIONMATLABMATLABDETECTEDMATLABDIRMATLABVERSIONNUMERICUninstallation command for legacy MAXMAX1UNINSTALLMAXDIR64Assistants Framework Dir 64-bit; currently uses a dummy locatorMAXAFWDIR64MAX base folder (64 bit)MAX INI File Dir; currently uses a dummy locatorMAXINIDIRVersion of NI MAXMAXVERSIONMAXVERSIONNUMERICMultisim Component Evaluator ADIMCE120ADIDETECTEDMultisim Component Evaluator Core version stringMCE120COREVERSIONMultisim Component Evaluator Core numeric versionMCE120COREVERSIONNUMERICMultisim Component Evaluator 12.0MCE120DIRMCE130ADIDETECTEDMCE130COREVERSIONMCE130COREVERSIONNUMERICMultisim Component Evaluator 13.0MCE130DIRMDACMDACVERSIONNUMERICMEASUREMENTSTUDIO60DETECTEDMeasurement Studio VC .netMEASUREMENTSTUDIO60VCNETDETECTEDMEASUREMENTSTUDIO60VCNETDIRMEASUREMENTSTUDIO60VERSIONMEASUREMENTSTUDIO60VERSIONNUMERICMeasurement Studio 7.0MEASUREMENTSTUDIO70DETECTEDMEASUREMENTSTUDIO70DIRMeasurement Studio 7.0 .NETMEASUREMENTSTUDIO70DOTNETDETECTEDMEASUREMENTSTUDIO70DOTNETDIRMEASUREMENTSTUDIO70VCNETDETECTEDMEASUREMENTSTUDIO70VCNETDIRMEASUREMENTSTUDIO70VERSIONMEASUREMENTSTUDIO70VERSIONNUMERICMEASUREMENTSTUDIOVERSIONMeasurement StudioMEASUREMENTSTUDIODETECTEDNIDIR, MEASUREMENTSTUDIOVERSIONMEASUREMENTSTUDIODIRMeasurement Studio .NETMEASUREMENTSTUDIODOTNETDETECTEDMEASUREMENTSTUDIOVERSION, MEASUREMENTSTUDIODIRMEASUREMENTSTUDIODOTNETDIRMeasurement Studio VCMEASUREMENTSTUDIOVCDETECTEDMEASUREMENTSTUDIOVCDIRMEASUREMENTSTUDIOVCNETDETECTEDMEASUREMENTSTUDIOVCNETDIRMEASUREMENTSTUDIOVERSIONNUMERICMeasurement Studio for Visual Studio 2003MEASUREMENTSTUDIOVS2003DETECTEDMEASUREMENTSTUDIOVS2003DIRMeasurement Studio VS 2003 .NETMEASUREMENTSTUDIOVS2003DOTNETDETECTEDMEASUREMENTSTUDIOVS2003DOTNETDIRMeasurement Studio VS 2003 FamilyMEASUREMENTSTUDIOVS2003FAMILYDETECTEDMEASUREMENTSTUDIOVS2003FAMILYDIRMeasurement Studio VS 2003 .NET VC .netMEASUREMENTSTUDIOVS2003VCNETDETECTEDMEASUREMENTSTUDIOVS2003VCNETDIRMEASUREMENTSTUDIOVS2003VERSIONMEASUREMENTSTUDIOVS2003VERSIONNUMERICMeasurement Studio VS 2005 CoreMEASUREMENTSTUDIOVS2005COREDETECTEDMEASUREMENTSTUDIOVS2005COREDIRMeasurement Studio VS 2005 VersionMEASUREMENTSTUDIOVS2005COREVERSIONNUMERICMeasurement Studio VS 2005 .NETMEASUREMENTSTUDIOVS2005DOTNETDETECTEDMEASUREMENTSTUDIOVS2005DOTNETDIRMeasurement Studio VS 2005 FamilyMEASUREMENTSTUDIOVS2005FAMILYDETECTEDMEASUREMENTSTUDIOVS2005FAMILYDIRMeasurement Studio VS 2005 VC .NETMEASUREMENTSTUDIOVS2005VCNETDETECTEDMEASUREMENTSTUDIOVS2005VCNETDIRMeasurement Studio VS 2008 CoreMEASUREMENTSTUDIOVS2008COREDETECTEDMEASUREMENTSTUDIOVS2008COREDIRMeasurement Studio VS 2008 VersionMEASUREMENTSTUDIOVS2008COREVERSIONNUMERICMeasurement Studio VS 2008 .NETMEASUREMENTSTUDIOVS2008DOTNETDETECTEDMEASUREMENTSTUDIOVS2008DOTNETDIRMeasurement Studio VS 2008 FamilyMEASUREMENTSTUDIOVS2008FAMILYDETECTEDMEASUREMENTSTUDIOVS2008FAMILYDIRMeasurement Studio VS 2008 VC .NETMEASUREMENTSTUDIOVS2008VCNETDETECTEDMEASUREMENTSTUDIOVS2008VCNETDIRMeasurement Studio VS 2010 CoreMEASUREMENTSTUDIOVS2010COREDETECTEDMEASUREMENTSTUDIOVS2010COREDIRMeasurement Studio VS 2010 VersionMEASUREMENTSTUDIOVS2010COREVERSIONNUMERICMeasurement Studio VS 2010 .NETMEASUREMENTSTUDIOVS2010DOTNETDETECTEDMEASUREMENTSTUDIOVS2010DOTNETDIRMeasurement Studio VS 2010 FamilyMEASUREMENTSTUDIOVS2010FAMILYDETECTEDMEASUREMENTSTUDIOVS2010FAMILYDIRMeasurement Studio VS 2012 CoreMEASUREMENTSTUDIOVS2012COREDETECTEDMEASUREMENTSTUDIOVS2012COREDIRMeasurement Studio VS 2012 VersionMEASUREMENTSTUDIOVS2012COREVERSIONNUMERICMeasurement Studio VS 2012 .NETMEASUREMENTSTUDIOVS2012DOTNETDETECTEDMEASUREMENTSTUDIOVS2012DOTNETDIRMeasurement Studio VS 2012 FamilyMEASUREMENTSTUDIOVS2012FAMILYDETECTEDMEASUREMENTSTUDIOVS2012FAMILYDIRMetaUninstaller detectedMETAUNINSTALLERDETECTEDMetaUninstaller DirectoryMETAUNINSTALLERDIRDisable MetaUninstaller OEM ARP pre-install NICustomExecuteMETAUNINSTALLERDISABLEOEMARPPRECAMetaUninstaller EXE NameMETAUNINSTALLEREXENAMEMetaUninstaller VersionMETAUNINSTALLERVERSIONMetaUninstaller Version NumericMETAUNINSTALLERVERSIONNUMERICLEGODIR, MINDSTORMSEDUNXTVERSIONFor LEGO Mindstorms Edu NXTMINDSTORMSEDUNXTDIRFor LEGO Mindstorms Edu NXT Highest VersionMINDSTORMSEDUNXTVERSIONNI Motion AssistantMOTIONASSISTANTDETECTEDNI Motion Assistant MOTIONASSISTANTDIRMOTIONASSISTANTVERSIONMOTIONASSISTANTVERSIONNUMERICMOZILLAVERSIONMozillaMOZILLADETECTEDMOZILLAVERSION, MOZILLAROOTDIRMOZILLADIRMOZILLAVERSION, MOZILLAROOTDIR, MOZILLADIRMozilla PluginsMOZILLAPLUGINSDIRMOZILLAROOTDIRNIDIR, NIPUBAPPDATADIR, MEASUREMENTSTUDIOVS2003VERSIONNUMERIC, MEASUREMENTSTUDIOVS2003DETECTEDMeasurement Studio VS 2003 PublicAppDataMSTUDIOVS2003PUBAPPDATADIRNIDIR, NIPUBDOCSDIR, MEASUREMENTSTUDIOVS2003VERSIONNUMERIC, MEASUREMENTSTUDIOVS2003DETECTEDMeasurement Studio VS 2003 PublicDocsMSTUDIOVS2003PUBDOCSDIRNIDIR, NIPUBAPPDATADIR, MEASUREMENTSTUDIOVS2005COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2005COREDETECTEDMeasurement Studio VS 2005 PublicAppDataMSTUDIOVS2005PUBAPPDATADIRNIDIR, NIPUBDOCSDIR, MEASUREMENTSTUDIOVS2005COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2005COREDETECTEDMeasurement Studio VS 2005 PublicDocsMSTUDIOVS2005PUBDOCSDIRNIDIR, NIPUBAPPDATADIR, MEASUREMENTSTUDIOVS2008COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2008COREDETECTEDMeasurement Studio VS 2008 PublicAppDataMSTUDIOVS2008PUBAPPDATADIRNIDIR, NIPUBDOCSDIR, MEASUREMENTSTUDIOVS2008COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2008COREDETECTEDMeasurement Studio VS 2008 PublicDocsMSTUDIOVS2008PUBDOCSDIRNIDIR, NIPUBAPPDATADIR, MEASUREMENTSTUDIOVS2010COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2010COREDETECTEDMeasurement Studio VS 2010 PublicAppDataMSTUDIOVS2010PUBAPPDATADIRNIDIR, NIPUBDOCSDIR, MEASUREMENTSTUDIOVS2010COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2010COREDETECTEDMeasurement Studio VS 2010 PublicDocsMSTUDIOVS2010PUBDOCSDIRNIDIR, NIPUBAPPDATADIR, MEASUREMENTSTUDIOVS2012COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2012COREDETECTEDMeasurement Studio VS 2012 PublicAppDataMSTUDIOVS2012PUBAPPDATADIRNIDIR, NIPUBDOCSDIR, MEASUREMENTSTUDIOVS2012COREVERSIONNUMERIC, MEASUREMENTSTUDIOVS2012COREDETECTEDMeasurement Studio VS 2012 PublicDocsMSTUDIOVS2012PUBDOCSDIRMS VB CCE 5.0MSVB50CCEDETECTEDMSVB50CCEPARENTDIRMSVB50CCEDIRRequired for MSVB50CCEDIRMS VB 5.0MSVB50DETECTEDMSVB50PARENTDIRMSVB50DIRRequired for MSVB50DIRMS VB 6.0MSVB60DETECTEDMSVB60PARENTDIRMSVB60DIRRequired for MSVB60DIRMS VB Templates DirMSVBTEMPLATESDIRMS VC 6.0MSVC60DETECTEDMSVC60PARENTDIRMSVC60DIRRequired for MSVC60DIRResolves to the Common directory in the Microsoft Visual Studio parent directoryMSVS60COMMONDIRTop-level directory for all installed MATRIXx versionsMTXHOMEDIRMXS versionMXSVERSIONMXS version numericMXSVERSIONNUMERICNETSCAPE4VERSIONNetscape 4.xNETSCAPE4DETECTEDNETSCAPEROOTDIR, NETSCAPE4VERSIONNETSCAPE4DIRNETSCAPE4VERSION, NETSCAPE4PLUGINSDIRPrivate, NETSCAPE4DIR, NETSCAPEROOTDIRNETSCAPE4PLUGINSDIRNETSCAPE4VERSION, NETSCAPE4DIR, NETSCAPEROOTDIRNETSCAPE4PLUGINSDIRPrivateNETSCAPE6VERSIONNetscape 6.xNETSCAPE6DETECTEDNETSCAPEROOTDIR, NETSCAPE6VERSIONNETSCAPE6DIRNETSCAPE6DIR, NETSCAPEROOTDIR, NETSCAPE6VERSIONNETSCAPE6PLUGINSDIRNETSCAPE7VERSIONNetscape 7.xNETSCAPE7DETECTEDNETSCAPEROOTDIR, NETSCAPE7VERSIONNETSCAPE7DIRNETSCAPE7DIR, NETSCAPEROOTDIR, NETSCAPE7VERSIONNETSCAPE7PLUGINSDIRNETSCAPESUBKEY, NETSCAPEVERSIONNetscape - Any VersionNETSCAPEDETECTEDNETSCAPEROOTDIR, NETSCAPESUBKEY, NETSCAPEVERSIONNetscape Directory - Highest VersionNETSCAPEDIRNetscape Plugins (Deprecated - will always return NO for Netscape 6.0+!)NETSCAPEPLUGINSDETECTEDNETSCAPEDIR, NETSCAPEROOTDIR, NETSCAPESUBKEY, NETSCAPEVERSIONNetscape Plugins (Deprecated - use version-specific NETSCAPEPLUGINSDIR properties!)NETSCAPEPLUGINSDIRRoot Netscape Directory - used to form default for other Netscape DIR propertiesNETSCAPEROOTDIRNetscape Registry Subkey - used to support other Netscape locatorsNETSCAPESUBKEYNetscape - Highest VersionNETSCAPEVERSIONNI-1588 ConfigurationNI1588CONFIGDETECTEDNI488VERSIONNI-488.2MNI488DETECTEDNIDIR, NI488VERSIONNI488DIRNI-488.2 - OEMNI488OEMDETECTEDNI488OEMVERSIONNI488VERSIONNUMERICNI-845x detection statusNI845XDETECTEDNI-845x location (based on [NIDIR])NI845XDIRNI-845x location (based on [NIPUBDOCSDIR])NI845XPUBDOCSDIRNI-985x location (based on [NIPUBDOCSDIR])NI985XPUBDOCSDIRNI ARP Fixup DetectedNIARPFIXDETECTEDNI ARP Fixup Run CommandNIARPFIXRUNCOMMANDNI ARP Fixup Run Key NameNIARPFIXRUNKEYNI-CEIPNICEIPDETECTEDNICEIPDETECTED64NICEIPDIRNICEIPDIR64NICEIPVERSIONNUMERICNICEIPVERSIONNUMERIC64CodeSign DLL 64-bit NameNICODESIGNAPI64DLLNAMENIMIFDIRCodeSign DLL DirectoryNICODESIGNAPIDIRMetaInstaller FrameworkCodeSign DLL NameNICODESIGNAPIDLLNAMECodeSign DLL VersionNICODESIGNAPIVERSIONNIDAQVERSIONNIDAQVERSIONNUMERICNI-DCPowerNIDCPOWERDETECTEDNIDCPOWERVERSIONNIDCPOWERVERSIONNUMERICNI-DeviceNIDEVICEDETECTEDNIDEVICEDIRNI-Device - OEMNIDEVICEOEMVERSIONNUMERICNIDEVICEVERSIONNIDEVICEVERSIONNUMERICNI-DMMNIDMMDETECTEDNIDMMVERSIONNIDMMVERSIONNUMERICParent dir for NIDRIVERMAPSDIRNIDRIVERDEVELOPMENTDIRFor xml-based map files ADEs use to map installed dependencies to NI installer upgrade codes for deployment with user-built installersNIDRIVERMAPSDIRLabVIEW errors filesNIERRORSDIRLabVIEW errors files 64-bitNIERRORSDIR64NI Example FinderNIEXFINDER10DETECTEDNIEXFINDERROOTDIRNIEXFINDER10DIRNIEXFINDERROOTDIR64NI Example Finder 64-bitNIEXFINDER10DIR64NIEXFINDER10VERSIONNIEXFINDER10VERSIONNUMERICNIEXFINDERBINVERSIONNIEXFINDERBINVERSIONNUMERICNIEXTCOMPILERSUPPDIRANSI C support files directoryNIEXTCCOMPILERSUPPDIRExternal compiler support files directoryNI-FBUS softwareNIFBUSDETECTEDNIFBUSDIRNI-FBUS monitorNIFBUSMONDETECTEDNIFBUSMONDIRNIFBUSMONVERSIONNIFBUSVERSIONNI-FGENNIFGENDETECTEDNIFGENVERSIONNIFGENVERSIONNUMERICNI-HSDIONIHSDIODETECTEDNIHSDIOVERSIONNIHSDIOVERSIONNUMERICNIIMAQ1394VERSIONNI-IMAQ for IEEE-1394 CamerasNIIMAQ1394DETECTEDNIDIR, NIIMAQ1394VERSIONNIIMAQ1394DIRNIIMAQ1394VERSIONNUMERICNI Camera File GeneratorNIIMAQCAMCONFIGDETECTEDNIIMAQDIR,NIIMAQUTILITYDIRNIIMAQCAMCONFIGDIRNI-IMAQNIIMAQDETECTEDNIDIR, NIIMAQVERSIONNIIMAQDIRNIIMAQDXVERSIONNI-IMAQdxNIIMAQDXDETECTEDNIDIR, NIIMAQDXVERSIONNIIMAQDXDIRNIIMAQDXVERSIONNUMERICNIIMAQIOVERSIONNI-IMAQ I/ONIIMAQIODETECTEDNIDIR, NIIMAQIOVERSIONNIIMAQIODIRNIIMAQIOVERSIONNUMERICNIIMAQDIR, NIIMAQVERSIONNI-IMAQ UtilitiesNIIMAQUTILITYDIRNIIMAQVERSIONNIIMAQVERSIONNUMERICNI IVINIIVIDIRIVI Shared DirectoryNIIVISHAREDDIRIVI EngineNIIVIVERSIONNIIVIVERSIONNUMERICNILEGALROOTDIRNotice file installation directoryNILEGALDIRRoot directory for legal files. Same as NIDIR, but not modifiable once set.NILMROOTDIRLicense Manager BinariesNILMBINDIRLicense ManagerNILMDETECTEDNILMEXENAMENILMROOTDIR, NILMROOT2DIRLicense Manager LicensesNILMLICENSESDIRNILMROOT2DIRNILMVERSIONNILMVERSIONNUMERICNIMCDETECTEDNI-MotionNIMCVERSIONNIMCVERSIONNUMERICNIMDFPUBAPPDATADIRNI MDF Binaries Installation DirectoryNIMDFBINDIRNI MDF Puiblic Application Data DirectoryNI MDFNIMDFDETECTEDNI MDF DirectoryNIMDFDIRNIMDFLEGALDIRNI MDF EULAs Installation DirectoryNIMDFEULADIRNI MDF legal files installation directoryNI MDF Manifest Installation DirectoryNIMDFMANIFESTDIRNIMDFVERSIONNIMDFVERSIONNUMERICNI-ORB; currently uses a dummy locatorNIORBDIRDetects whether NI PQA is installed.NIPQADETECTEDRoot directory for NI PQA.NIPQADIRVersion of NI PQA installed.NIPQAVERSIONNIPQAVERSIONNUMERICProduct Installer Cache root directoryNIPRODUCTCACHEDIRShared Dir in NIPUBAPPDATADIRNIPUBAPPDATASHAREDDIRNI PXI DirectioryNIPXIDIRPeripheral Module Driver PathNIPXIEPERIPHERALDRIVERDLLNIREGWIZARDROOTDIRNI Registration Wizard BinariesNIREGWIZARDBINDIRNI Registration WizardNIREGWIZARDDETECTEDNIREGWIZARDEXENAMENIREGWIZARDVERSIONNIREGWIZARDVERSIONNUMERICNI-RFSANIRFSADETECTEDNIRFSAVERSIONNIRFSAVERSIONNUMERICNI-RFSGNIRFSGDETECTEDNIRFSGDIRNIRFSGVERSIONNIRFSGVERSIONNUMERICNI-RIONIRIODETECTEDNIRIODIRNIRIOVERSIONNIRIOVERSIONNUMERICNI-ScopeNISCOPEDETECTEDNISCOPEDIRNISCOPEVERSIONNISCOPEVERSIONNUMERICNI Switch ExecutiveNISEDETECTEDNISEDIRNI-Serial 1.42NISERIAL142DETECTEDNISERIAL142DIRNI-Serial 1.43NISERIAL143DETECTEDNISERIAL143DIRNI-Serial 1.44NISERIAL144DETECTEDNISERIAL144DIRNI-Serial 1.45NISERIAL145DETECTEDNISERIAL145DIRNI-Serial 1.5NISERIAL150DETECTEDNISERIAL150DIRNI-SerialNISERIALDETECTEDNISERIALDIRNISERIALVERSIONNISERIALVERSIONNUMERICNISEVERSIONNISEVERSIONNUMERICPath to LabVIEW shared help index folderNISHAREDLVHELPINDEXDIRNI Shared Memory DirNISHAREDMEMORYDIRNI-SwitchNISWITCHDETECTEDNISWITCHVERSIONNISWITCHVERSIONNUMERICThe installed path to NI-SyncNISYNCDETECTEDNITIMESYNCDETECTEDNI TunerNITUNERDETECTEDNITUNERDIRNITUNERVERSIONNITUNERVERSIONNUMERICDetects if NI Update Service is installedNIUPDATESERVICEDETECTEDNI Update Service install directoryNIUPDATESERVICEDIRNI Update Service executable nameNIUPDATESERVICEEXENAMENI Update Service Full NIUPDATESERVICEFULLDETECTEDNI Update Service versionNIUPDATESERVICEVERSIONNI Update Service numeric versionNIUPDATESERVICEVERSIONNUMERICNI-USI detectedNIUSIDETECTEDNI Visa PDANIVISAPDADETECTEDNIVISAPDAVERSIONNIVISAPDAVERSIONNUMERICNI VisaNIVISAVERSIONNIVISAVERSIONNUMERICDetects whether NI VMS is installed.NIVMSDETECTEDRoot directory for NI VMS.NIVMSDIRVersion of NI VMS installed.NIVMSVERSIONNIVMSVERSIONNUMERICNI-VXINIVXINI-VXI2NIVXI2DETECTEDNIVXI3DIRNIVXI2DIRNI-VXI3NIVXI3DETECTEDNIVXIVERSIONNUMERICNIXMLDIRInstallation directory for Xerces filesNIXERCESDIRParent Directory of NIXERCESDIRNIXMLDIR6464-bit installation directory for Xerces filesNIXERCESDIR6464-bit Parent Directory of NIXERCESDIRNI-PalPALDETECTEDPalm OS Desktop SoftwarePALMDETECTEDPALMDIRNI-PAL VersionPALVERSIONPALVERSIONNUMERICNI Portable ConfigurationPORTCFGCMDLINETOOL1PORTCFGDETECTEDPORTCFGDIRPORTCFGTASKCREATE1PORTCFGVERSIONPORTCFGVERSIONNUMERICPXISADESCRIPTIONDIRPXI Chassis Description DirectoryPXICHASSISDIRPXISADIRParent dir for PXICHASSISDIR and PXIMODULEDIRPXIHARDWAREDESCDIRPXI Controller Description DirectoryPXICONTROLLERDIRPXI Hardware Description DirectoryPXI Module Description DirectoryPXIMODULEDIRPXISA standard program data directoryNI RF Signal AnalyzerRFSIGNALANALYZERDETECTEDNIDIR, NIRFSAVERSIONNUMERICRFSIGNALANALYZERDIRNI Signal AnalyzerRFSIGNALANALYZERVERSIONRFSIGNALANALYZERVERSIONNUMERICRemote System ExplorerRSEDETECTEDRSEDIRR Series Core Installer ProductsRSERIESDETECTEDRSERIESDIRRSERIESVERSIONRSERIESVERSIONNUMERICLabVIEW RT 2010RT2010DETECTEDRT2010LANGRT 2010 Target SupportRT2010TARGSUPPORTDETECTEDLabVIEW RT 2011RT2011DETECTEDRT2011LANGRT2011TARGSUPPORTDETECTEDRT2012DETECTEDRT2012LANGRT2012TARGSUPPORTDETECTEDLabVIEW RT 2013RT2013DETECTEDRT2013LANGRT2013TARGSUPPORTDETECTEDLabVIEW RT 2014RT2014DETECTEDRT2014LANGRT2014TARGSUPPORTDETECTEDLabVIEW RT 6.1RT61DETECTEDLabVIEW RT 7.0RT70DETECTEDLabVIEW RT 7.1RT71DETECTEDLabVIEW RT 8.0RT80DETECTEDRT 8.0 Target SupportRT80TARGSUPPORTDETECTEDRT80TARGSUPPORTVERSIONRT80TARGSUPPORTVERSIONNUMERICLabVIEW RT 8.2RT82DETECTEDRT 8.2 Target SupportRT82TARGSUPPORTDETECTEDRT82TARGSUPPORTVERSIONRT82TARGSUPPORTVERSIONNUMERICLabVIEW RT 8.5RT85DETECTEDRT 8.5 Target SupportRT85TARGSUPPORTDETECTEDLabVIEW RT 8.6RT86DETECTEDRT 8.6 Target SupportRT86TARGSUPPORTDETECTEDLabVIEW RT 86 VersionNumericRT86VERSIONNUMERICLabVIEW RT 2009RT90DETECTEDRT 2009 Target SupportRT90TARGSUPPORTDETECTEDLabVIEW RT 2009 VersionNumericRT90VERSIONNUMERICLV RT VersionStringRTDETECTEDReal-Time Execution Trace Toolkit 2.0RTETT20DIRLabVIEW RT ImagesRTIMAGEDETECTEDRTIMAGEDIRRTRTXVERSION, LVVERSIONLabVIEW RT for RTXRTRTXDETECTEDRTX Target SupportRTRTXTARGSUPPORTDETECTEDRTRTXTARGSUPPORTVERSIONRTRTXTARGSUPPORTVERSIONNUMERICRTRTXVERSIONRTRTXVERSIONNUMERICRTTARGSUPPORTVERSIONRT Target SupportRTTARGSUPPORTDETECTEDRTTARGSUPPORTVERSIONNUMERICRTVERSIONRTVERSIONNUMERICArdence RTX EngineRTXENGINEDETECTEDRTXENGINEDIRRTXENGINEVERSIONRTXENGINEVERSIONNUMERICRTXROOTDIRSignalExpressSEDETECTEDSEDIRLocation for SignalExpress ExamplesSEEXAMPLESDIRSEVERSIONSEVERSIONNUMERICSpectral Measurements Toolkit - CVI SupportSMTCVIDETECTEDSpectral Measurements ToolsetSMTDETECTEDSMTDIRSpectral Measurements Toolkit - LabVIEW SupportSMTLVDETECTEDSpectral Measurements Toolkit RuntimeSMTRTDETECTEDSMTRTVERSIONSMTVERSIONSMTVERSIONNUMERICIf NI SoftMotion 8.6 Is Installed On The SystemSOFTMOTION86DETECTEDThe Installation Directory for NI SoftMotion 8.6SOFTMOTION86DIRThe String Version for NI SoftMotion 8.6SOFTMOTION86VERSIONThe Numeric Version for NI SoftMotion 8.6SOFTMOTION86VERSIONNUMERICSoftMotionSOFTMOTIONDETECTEDSOFTMOTIONDIRSoftMotion SDKSOFTMOTIONSDKDETECTEDSOFTMOTIONSDKDIRSOFTMOTIONSDKVERSIONSOFTMOTIONSDKVERSIONNUMERICSOFTMOTIONVERSIONSOFTMOTIONVERSIONNUMERICSignal Processing ToolkitSPTLV71VERSIONSPTLVVERSIONNI SpySPYDETECTEDSPYDIRTimken StatusCheck OEM products detectedSTATUSCHECKDETECTEDTIMKENDIRDirectory for Timken StatusCheck OEM productsSTATUSCHECKDIRDummy parent dir just to define STATUSCHECKDIRTestStand 100 TESTSTAND100DIRTestStand 101 TESTSTAND101DIRTestStand 102 TESTSTAND102DIRTestStand 103 TESTSTAND103DIRTestStand 200 TESTSTAND200DIRTestStand 201 TESTSTAND201DIRTestStand 300 TESTSTAND300DIRTestStand 310TESTSTAND310DETECTEDTESTSTAND310DIRTestStand 350TESTSTAND350DETECTEDTESTSTAND350DIRTestStand 400 detectedTESTSTAND400DETECTEDTestStand 400TESTSTAND400DIRTestStand 410 detectedTESTSTAND410DETECTEDTestStand 410TESTSTAND410DIRTestStand 410 application dataTESTSTAND410PUBAPPDATADIRTestStand 410 global dataTESTSTAND410PUBDOCSDIRTestStand 411 detectedTESTSTAND411DETECTEDTestStand 411TESTSTAND411DIRTestStand 411 application dataTESTSTAND411PUBAPPDATADIRTestStand 411 global dataTESTSTAND411PUBDOCSDIRTeststand 420 detectedTESTSTAND420DETECTEDTeststand 420TESTSTAND420DIRTestStand 420 application dataTESTSTAND420PUBAPPDATADIRTestStand 420 global dataTESTSTAND420PUBDOCSDIRTestStand 421 detectedTESTSTAND421DETECTEDTestStand 421TESTSTAND421DIRTestStand 421 application dataTESTSTAND421PUBAPPDATADIRTestStand 421 global dataTESTSTAND421PUBDOCSDIRTestStand 450 detectedTESTSTAND450DETECTEDTestStand 450TESTSTAND450DIRTestStand 450 application dataTESTSTAND450PUBAPPDATADIRTestStand 450 global dataTESTSTAND450PUBDOCSDIRTestStand 451 detectedTESTSTAND451DETECTEDTestStand 451TESTSTAND451DIRTestStand 451 application dataTESTSTAND451PUBAPPDATADIRTestStand 451 global dataTESTSTAND451PUBDOCSDIRTestStand 500 detectedTESTSTAND500DETECTEDTestStand 500TESTSTAND500DIRTestStand 500 application dataTESTSTAND500PUBAPPDATADIRTestStand 500 global dataTESTSTAND500PUBDOCSDIRTestStand 510 detectedTESTSTAND510DETECTEDTestStand 510TESTSTAND510DIRTestStand 510 application dataTESTSTAND510PUBAPPDATADIRTestStand 510 global dataTESTSTAND510PUBDOCSDIRTESTSTANDVERSIONTestStand TESTSTANDDETECTEDNIDIR, TESTSTANDVERSIONTESTSTANDDIRTESTSTANDVERSIONNUMERICTest & Measurement ExplorerTMEXPLORERDETECTEDTMEXPLORERDIRUSISHAREDDIRUSI 2.0 DirectoryUSI20DIRUSI Directory in NISHAREDDIRdetect whether USI 64 had been installed on the target machineUSI64DETECTEDThis NI Path is the USI bin directoryUSIBINDIRUSISHAREDDIR64USI bin 64 directoryUSIBINDIR64USI 64 directoryThis NI Path is used to detected whether USI had been installed on the target machineUSIDETECTEDUSIPUBAPPDATASHAREDDIRUSI Plugin DirectoryUSIPLUGINDIRUSI Shared Dir in NIPUBAPPDATADIRThe directory for NI USRP-RIO filesUSRPRIODIRUSRPRIODIR64NI ValueMotionVALUEMOTIONDETECTEDVALUEMOTIONDIRVALUEMOTIONVERSIONVALUEMOTIONVERSIONNUMERICVenturComVENTURCOMDIRThis dir property points to the installation directory of VeriStand 2011VERISTAND2011DIRThis dir property points to the installation directory of VeriStand 2012VERISTAND2012DIRThis dir property points to the installation directory of VeriStand 2013VERISTAND2013DIRVERISTANDVERSIONWhether NI VeriStand has been installed on the target machineVERISTANDDETECTEDVeriStand (highest installed VersionString)NI VI LoggerVILOGGERDETECTEDVILOGGERDIRVILOGGERTYPEVILOGGERVERSIONVILOGGERVERSIONNUMERICNI VISA 64-bitVISA64DETECTEDNI VISAVISADETECTEDVXIPNPDIRVISADIRNI VXI PNPVXIPNPDIR64VISADIR64NI VXI PNP 64-bitVISA Framework DirVISAFRAMEWORKDIRVISA Framework Dir 64-bitVISAFRAMEWORKDIR64IMAQ Vision for CVIVISIONCVIDETECTEDVISIONCVIVERSIONVISIONVERSION, VISIONVERSIONNUMERICIMAQ VisionVISIONDETECTEDNIDIR, VISIONNIDIR, VISIONVERSION, VISIONVERSIONNUMERICVISIONDIRVISIONLVCURRENTVERSIONIMAQ Vision 5.1 for LabVIEWVISIONLV51DETECTEDIMAQ Vision for LabVIEWNIDIR, VISIONLVCURRENTVERSIONVISIONLV51DIRVISIONLV51VERSIONIMAQ Vision 6.0 for LabVIEWVISIONLV60DETECTEDVISIONLV60DIRVISIONLV60VERSIONIMAQ Vision 6.1 for LabVIEWVISIONLV61DETECTEDVISIONLV61DIRVISIONLV61VERSIONIMAQ Vision 5.0 for LabVIEWVISIONLVDETECTEDVISIONLVDIRVISIONLVVERSIONVISIONVERSIONVISIONVERSIONNUMERICVolume License ManagerVLMDETECTEDVLMDIRVLMVERSIONVLMVERSIONNUMERICVisual Studio .NET 10.0VSNET100DETECTEDVSNET100DIRVisual Studio .NET 11.0VSNET110DETECTEDVSNET110DIRVisual Studio .NET 7.0VSNET70DETECTEDVSNET70DIRVSNET70VERSIONVisual Studio .NET 7.1VSNET71DETECTEDVSNET71DIRVSNET71VERSIONVisual Studio .NET 8.0VSNET80DETECTEDVSNET80DIRVisual Studio .NET 9.0VSNET90DETECTEDVSNET90DIRVXIPNP64DETECTEDVXIPNPDETECTEDNI-XNET (64-bit)XNET64DETECTEDNI-XNETXNETDETECTEDXNETDIRXNETDIR64ACTIVESYNCDIRRegLocAMTCVIDIRRegLocAMTLVDIRRegLocAMTRTVERSIONRegLocATMLTK100RegLocATMLTK200RegLocATMLTK300RegLocAUDIOMASTERVERSIONRegLocAWEDIRRegLocBCB40DIRRegLocBCB50DIRRegLocBVDIRRegLocCALEXECDIRRegLocCANVERSIONRegLocCDS101DIRRegLocCDS110DIRRegLocCDS110EDUDIRRegLocCDS110PRODIRRegLocCDS120EDUDETECTEDRegLocCDS120PRODETECTEDRegLocCDS130DIRRegLocCDS130EDUDETECTEDRegLocCDS130PRODETECTEDRegLocCOMPACTRIOVERSIONRegLocCONDITIONMONDIRRegLocCRIOVERSIONRegLocCVI2010DIRRegLocCVI2012DIRRegLocCVI2013DIRRegLocCVI400DIRRegLocCVI401DIRRegLocCVI500DIRRegLocCVI550DIRRegLocCVI600DIRRegLocCVI700DIRRegLocCVI710DIRRegLocCVI800DIRRegLocCVI810DIRRegLocCVI850DIRRegLocCVI900DIRRegLocCVI910DIRRegLocCVIDIRRegLocCVIRT2010VERSIONRegLocCVIRT2010TARGSUPPORTDIRRegLocCVIRT2012VERSIONRegLocCVIRT2012TARGSUPPORTDIRRegLocCVIRT2013VERSIONRegLocCVIRT2013TARGSUPPORTDIRRegLocCVIRT80VERSIONRegLocCVIRT80TARGSUPPORTDIRRegLocCVIRT81VERSIONRegLocCVIRT81TARGSUPPORTDIRRegLocCVIRT85VERSIONRegLocCVIRT85TARGSUPPORTDIRRegLocCVIRT90VERSIONRegLocCVIRT90TARGSUPPORTDIRRegLocCVIRT91VERSIONRegLocCVIRT91TARGSUPPORTDIRRegLocCVIRTVERSIONRegLocCVIRTTARGSUPPORTVERSIONRegLocDAQCONFIGVERSIONNUMERICRegLocDAQDIRRegLocDAQFULLVERSIONNUMERICRegLocDAQMXBASEDIRRegLocDAQMXDIRRegLocDATASOCKETDIRRegLocDCOM9XVERSIONRegLocDEVICENETVERSIONNUMERICRegLocDIADEM101DIRRegLocDIADEM102DIRRegLocDIADEM10DIRRegLocDIADEMDIRRegLocDMTCVIDIRRegLocDMTDIRRegLocDMTLVDIRRegLocDNETDIRRegLocDNP3VERSIONNUMERICRegLocDOTNET10RegLocDOTNET11RegLocDOTNET20RegLocDOTNET30RegLocDOTNET35RegLocDOTNET40RegLocDOTNET45RegLocDOTNETDIRRegLocELVISDETECTEDRegLocEMBVC40DIRRegLocFIELDPOINTDETECTEDRegLocFIREFOXDIRRegLocFLEXMOTIONDIRRegLocFPGA2010VERSIONRegLocFPGA2011VERSIONRegLocFPGA2012VERSIONRegLocFPGA2013VERSIONRegLocFPGA2014VERSIONRegLocFPGA70VERSIONRegLocFPGA71VERSIONRegLocFPGA80VERSIONRegLocFPGA82VERSIONRegLocFPGA85VERSIONRegLocFPGA86VERSIONRegLocFPGA90VERSIONRegLocFPGAVERSIONRegLocGATEWAY100DIRRegLocGATEWAY110DIRRegLocGATEWAY2012DIRRegLocGPIB488VERSIONRegLocICPVERSIONRegLocIDT20VERSIONRegLocIDTVERSIONRegLocIEC61850VERSIONNUMERICRegLocIEDETECTEDRegLocIEDIRRegLocINTERFACESDIRRegLocIVB60DIRRegLocIVB60JDIRRegLocIVB61DIRRegLocIVBDIRRegLocIVIENGINEPACKAGEVERSIONRegLocIVIVISACOMVERSIONRegLocLKCLIENT51DETECTEDRegLocLKCLIENT60DETECTEDRegLocLKCLIENT61DETECTEDRegLocLKCLIENT62DETECTEDRegLocLKCLIENT65DETECTEDRegLocLKCLIENT66DETECTEDRegLocLKCLIENT67DETECTEDRegLocLKCLIENTDETECTEDRegLocLKDEV51DETECTEDRegLocLKDEV60DETECTEDRegLocLKDEV61DETECTEDRegLocLKDEV62DETECTEDRegLocLKDEV65DETECTEDRegLocLKDEV66DETECTEDRegLocLKDEV67DETECTEDRegLocLKDEVDETECTEDRegLocLKPLAYER51DETECTEDRegLocLKPLAYER60DETECTEDRegLocLKPLAYER61DETECTEDRegLocLKPLAYER62DETECTEDRegLocLKPLAYER65DETECTEDRegLocLKPLAYER66DETECTEDRegLocLKPLAYER67DETECTEDRegLocLKPLAYERDETECTEDRegLocLOGOS40DIRRegLocLOGOSDETECTEDRegLocLOOKOUT40DIRRegLocLV2010DIRRegLocLV2010FFRTEDIRRegLocLV2010ROBOVERSIONRegLocLV2010RTEDIRRegLocLV2011DIRRegLocLV2011FFRTEDIRRegLocLV2011ROBOVERSIONRegLocLV2011RTEDIRRegLocLV2012DIRRegLocLV2012FFRTEDIRRegLocLV2012ROBOVERSIONRegLocLV2012RTEDIRRegLocLV2013DIRRegLocLV2013FFRTEDIRRegLocLV2013ROBOVERSIONRegLocLV2013RTEDIRRegLocLV2014DIRRegLocLV2014FFRTEDIRRegLocLV2014ROBOVERSIONRegLocLV2014RTEDIRRegLocLV501DIRRegLocLV50DIRRegLocLV51DIRRegLocLV5DIRRegLocLV60DIRRegLocLV61DIRRegLocLV61RTEDIRRegLocLV70DIRRegLocLV70RTEDIRRegLocLV71DIRRegLocLV71DSPDIRRegLocLV71EMBDIRRegLocLV71RTEDIRRegLocLV80DIRRegLocLV80FFRTEDIRRegLocLV80RTEDIRRegLocLV82DIRRegLocLV82FFRTEDIRRegLocLV82RTEDIRRegLocLV85DIRRegLocLV85FFRTEDIRRegLocLV85RTEDIRRegLocLV86DIRRegLocLV86FFRTEDIRRegLocLV86FFRTEDIR64RegLocLV86RTEDIRRegLocLV90DIRRegLocLV90FFRTEDIRRegLocLV90ROBOVERSIONRegLocLV90RTEDIRRegLocLVBROKERDIRRegLocLVDIRRegLocLVDIR64RegLocLVDSCRTSDIRRegLocLVFFRTEVERSIONRegLocLVFFRTEVERSION64RegLocLVPPC2010DETECTEDRegLocLVPPC2012DETECTEDRegLocLVPPC70DETECTEDRegLocLVPPC71DETECTEDRegLocLVPPC80DETECTEDRegLocLVPPC82DETECTEDRegLocLVPPC85DIRRegLocLVPPC86DIRRegLocLVPPC90DIRRegLocLVPPCVERSIONRegLocLVROBODETECTEDRegLocLVTP2010DETECTEDRegLocLVTP2012DETECTEDRegLocLVTP82DETECTEDRegLocLVTP85DIRRegLocLVTP86DIRRegLocLVTP90DIRRegLocMATLAB61DIRRegLocMATLAB65DIRRegLocMATLAB6DIRRegLocMATLABDIRRegLocMCE120ADIDETECTEDRegLocMCE130ADIDETECTEDRegLocMEASUREMENTSTUDIO60DIRRegLocMEASUREMENTSTUDIO60VCNETDIRRegLocMEASUREMENTSTUDIO70DIRRegLocMEASUREMENTSTUDIO70DOTNETDIRRegLocMEASUREMENTSTUDIO70VCNETDIRRegLocMEASUREMENTSTUDIODIRRegLocMEASUREMENTSTUDIODOTNETDIRRegLocMEASUREMENTSTUDIOVCDIRRegLocMEASUREMENTSTUDIOVCNETDIRRegLocMEASUREMENTSTUDIOVS2003FAMILYDIRRegLocMEASUREMENTSTUDIOVS2005COREDIRRegLocMEASUREMENTSTUDIOVS2005DOTNETDIRRegLocMEASUREMENTSTUDIOVS2005FAMILYDIRRegLocMEASUREMENTSTUDIOVS2005VCNETDIRRegLocMEASUREMENTSTUDIOVS2008COREDIRRegLocMEASUREMENTSTUDIOVS2008DOTNETDIRRegLocMEASUREMENTSTUDIOVS2008FAMILYDIRRegLocMEASUREMENTSTUDIOVS2008VCNETDIRRegLocMEASUREMENTSTUDIOVS2010COREDIRRegLocMEASUREMENTSTUDIOVS2010DOTNETDIRRegLocMEASUREMENTSTUDIOVS2010FAMILYDIRRegLocMEASUREMENTSTUDIOVS2012COREDIRRegLocMEASUREMENTSTUDIOVS2012DOTNETDIRRegLocMEASUREMENTSTUDIOVS2012FAMILYDIRRegLocMETAUNINSTALLERVERSIONRegLocMOTIONASSISTANTDIRRegLocMOZILLADIRRegLocMSVB50CCEDIRRegLocMSVB50DIRRegLocMSVB60DIRRegLocMSVC60DIRRegLocNETSCAPE4DIRRegLocNETSCAPE6DIRRegLocNETSCAPE7DIRRegLocNETSCAPEDIRRegLocNETSCAPEPLUGINSDIRRegLocNI1588CONFIGDETECTEDRegLocNI488DIRRegLocNI488OEMVERSIONRegLocNI845XDIRRegLocNIARPFIXRUNKEYRegLocNICEIPDIRRegLocNIDCPOWERVERSIONRegLocNIDEVICEDIRRegLocNIDMMVERSIONRegLocNIEXFINDER10DIRRegLocNIFBUSDIRRegLocNIFBUSMONDIRRegLocNIFGENVERSIONRegLocNIHSDIOVERSIONRegLocNIIMAQ1394DIRRegLocNIIMAQCAMCONFIGDIRRegLocNIIMAQVERSIONRegLocNIIMAQDXDIRRegLocNIIMAQIODIRRegLocNILMBINDIRRegLocNIMCDIRRegLocNIMDFDIRRegLocNIPQAVERSIONRegLocNIREGWIZARDBINDIRRegLocNIRFSAVERSIONRegLocNIRFSGDIRRegLocNIRIOVERSIONRegLocNISCOPEDIRRegLocNISEDIRRegLocNISERIAL142DETECTEDRegLocNISERIAL143DETECTEDRegLocNISERIAL144DETECTEDRegLocNISERIAL145DETECTEDRegLocNISERIAL150DETECTEDRegLocNISERIALDIRRegLocNISWITCHVERSIONRegLocNISYNCDIRRegLocNITIMESYNCDIRRegLocNITUNERDIRRegLocNIUPDATESERVICEDIRRegLocNIUPDATESERVICEFULLRegLocNIUSIDETECTEDRegLocNIVISAPDAVERSIONRegLocNIVMSVERSIONRegLocNIVXI2DIRRegLocNIVXI3DIRRegLocPALVERSIONRegLocPALMDIRRegLocPORTCFGDIRRegLocRFSIGNALANALYZERDIRRegLocRSEDIRRegLocRSERIESVERSIONRegLocRT2010VERSIONRegLocRT2010TARGSUPPORTDIRRegLocRT2011VERSIONRegLocRT2011TARGSUPPORTDIRRegLocRT2012VERSIONRegLocRT2012TARGSUPPORTDIRRegLocRT2013VERSIONRegLocRT2013TARGSUPPORTDIRRegLocRT2014VERSIONRegLocRT2014TARGSUPPORTDIRRegLocRT61DETECTEDRegLocRT70DETECTEDRegLocRT71DETECTEDRegLocRT80DETECTEDRegLocRT80TARGSUPPORTDIRRegLocRT82DETECTEDRegLogRT82TARGSUPPORTDIRRegLocRT85DETECTEDRegLogRT85TARGSUPPORTDIRRegLocRT86VERSIONRegLocRT86TARGSUPPORTDIRRegLocRT90VERSIONRegLocRT90TARGSUPPORTDIRRegLocRTVERSIONRegLocRTIMAGEDIRRegLocRTRTXDIRRegLocRTRTXTARGSUPPORTDIRRegLocRTTARGSUPPORTDIRRegLocRTXENGINEDIRRegLocSEDIRRegLocSMTCVIDETECTEDRegLocSMTDIRRegLocSMTLVDETECTEDRegLocSMTRTVERSIONRegLocSOFTMOTION86DIRRegLocSOFTMOTIONDIRRegLocSOFTMOTIONSDKDIRRegLocSPYDIRRegLocSTATUSCHECKDIRRegLocTESTSTAND310DIRRegLocTESTSTAND350DIRRegLocTESTSTAND400DIRRegLocTESTSTAND410DIRRegLocTESTSTAND411DIRRegLocTESTSTAND420DIRRegLocTESTSTAND421DIRRegLocTESTSTAND450DIRRegLocTESTSTAND451DIRRegLocTESTSTAND500DIRRegLocTESTSTAND510DIRRegLocTESTSTANDDIRRegLocTMEXPLORERDIRRegLocUSIDETECTEDRegLocVALUEMOTIONDIRRegLocVERISTANDDIRRegLocVILOGGERDIRRegLocVISA64DIRRegLocVISADIRRegLocVISIONCVIVERSIONRegLocVISIONVERSIONRegLocVISIONLV51DETECTEDRegLocVISIONLV60DETECTEDRegLocVISIONLV61DETECTEDRegLocVISIONLVDETECTEDRegLocVLMDIRRegLocVSNET100DIRRegLocVSNET110DIRRegLocVSNET70DIRRegLocVSNET71DIRRegLocVSNET80DIRRegLocVSNET90DIRRegLocVXIPNPDIRRegLocXNETDIR64RegLocXNETDIRRegLocStdPathInstalledDirSOFTWARE\Microsoft\Windows CE ServicesCVIPathSoftware\National Instruments\Modulation Toolkit\Analog Modulation Toolkit\CurrentVersionLabVIEWPathStdVersionRuntimeVersionKeyDetectedThisKeySOFTWARE\National Instruments\TestStand ATML Toolkit\1.0SOFTWARE\National Instruments\TestStand ATML Toolkit\2.0SOFTWARE\National Instruments\TestStand ATML Toolkit\3.0Software\National Instruments\AudioMASTER\CurrentVersionPathSOFTWARE\National Instruments\AWE\CurrentVersionRootDirSOFTWARE\Borland\C++Builder\4.0SOFTWARE\Borland\C++Builder\5.0Software\National Instruments\BridgeVIEW\CurrentVersionInstallDirSoftware\National Instruments\Calibration ExecutiveCurrentVersionSOFTWARE\National Instruments\NI-CAN\CurrentVersionSoftware\National Instruments\Circuit Design Suite\10.1\MSI Parts\CoreSoftware\National Instruments\Circuit Design Suite\11.0\MSI Parts\CoreSoftware\National Instruments\Circuit Design Suite\11.0\MSI Parts\EduSoftware\National Instruments\Circuit Design Suite\11.0\MSI Parts\ProSoftware\National Instruments\Circuit Design Suite\12.0\MSI Parts\EduSoftware\National Instruments\Circuit Design Suite\12.0\MSI Parts\ProSoftware\National Instruments\Circuit Design Suite\13.0\MSI Parts\CoreSoftware\National Instruments\Circuit Design Suite\13.0\MSI Parts\EduSoftware\National Instruments\Circuit Design Suite\13.0\MSI Parts\ProSOFTWARE\National Instruments\CompactRIO\CurrentVersionSOFTWARE\National Instruments\Condition Monitoring SuiteSoftware\National Instruments\CVI\10.0Software\National Instruments\CVI\12.0Software\National Instruments\CVI\13.0Software\National Instruments\CVI\4.0.0Software\National Instruments\CVI\4.0.1Software\National Instruments\CVI\5.0Software\National Instruments\CVI\5.5Software\National Instruments\CVI\6.0Software\National Instruments\CVI\7.0Software\National Instruments\CVI\7.1Software\National Instruments\CVI\8.0Software\National Instruments\CVI\8.1Software\National Instruments\CVI\8.5Software\National Instruments\CVI\9.0Software\National Instruments\CVI\9.1Software\National Instruments\CVI\[CVIVERSION]SOFTWARE\National Instruments\CVI\10.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\10.0SOFTWARE\National Instruments\CVI\12.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\12.0SOFTWARE\National Instruments\CVI\13.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\13.0SOFTWARE\National Instruments\CVI\8.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\8.0SOFTWARE\National Instruments\CVI\8.1\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\8.1SOFTWARE\National Instruments\CVI\8.5\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\8.5SOFTWARE\National Instruments\CVI\9.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\9.0SOFTWARE\National Instruments\CVI\9.1\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\CVI\9.1SOFTWARE\National Instruments\CVI\[CVIVERSION]\AddOns\Real-TimeHighestVersionKeySOFTWARE\National Instruments\RT Images\CVIConfigurationRuntimeVersionSOFTWARE\National Instruments\NI-DAQmx\CurrentVersionSoftware\National Instruments\NI-DAQ\CurrentVersionADERuntimeVersionSOFTWARE\National Instruments\NI-DAQmx Base\CurrentVersionSoftware\National Instruments\NI-DAQmx\CurrentVersionSoftware\National Instruments\DataSocketCLSID\{bdc67890-4fc0-11d0-a805-00aa006d2ea4}\InstalledVersionSOFTWARE\National Instruments\NI-Industrial Communications for DeviceNet\CurrentVersionSoftware\National Instruments\DIAdem\10.1SOFTWARE\National Instruments\DIAdem\10.2Software\National Instruments\DIAdem\10.0SOFTWARE\National Instruments\DIAdem\[DIADEMVERSION]Software\National Instruments\Modulation Toolkit\Digital Modulation Toolkit\CurrentVersionSoftware\National Instruments\Modulation ToolkitSOFTWARE\National Instruments\NI-DNET\CurrentVersionSOFTWARE\National Instruments\NI-Industrial Communications for DNP3\CurrentVersionSoftware\Microsoft\.NETFramework\policy\v1.0Software\Microsoft\.NETFramework\policy\v1.1Software\Microsoft\.NETFramework\policy\v2.0RawNumericInstallSuccessSOFTWARE\Microsoft\NET Framework Setup\NDP\v3.0\SetupSOFTWARE\Microsoft\NET Framework Setup\NDP\v3.5SOFTWARE\Microsoft\NET Framework Setup\NDP\v4ReleaseSOFTWARE\Microsoft\NET Framework Setup\NDP\v4\FullInstallRootSoftware\Microsoft\.NETFrameworkSoftware\National Instruments\NI ELVIS\CurrentVersionProductDirSOFTWARE\Microsoft\Windows CE Developer Tools\eMbedded Visual C++ 4.0Software\National Instruments\FieldPoint\[FIELDPOINTVERSIONPrivate]LaunchInstall DirectorySOFTWARE\Mozilla\Mozilla Firefox\[FIREFOXVERSION]\MainSoftware\National Instruments\Motion\FlexMotion\CurrentVersionSoftware\National Instruments\FlexMotion\CurrentVersionSOFTWARE\National Instruments\LabVIEW\10.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\11.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\12.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\13.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\14.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\7.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\7.1\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\8.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\8.2\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\8.5\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\8.6\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\9.0\AddOns\FPGASOFTWARE\National Instruments\LabVIEW\AddOns\FPGASOFTWARE\National Instruments\Requirements Gateway\1.0SOFTWARE\National Instruments\Requirements Gateway\1.1SOFTWARE\National Instruments\Requirements Gateway\1.2SOFTWARE\GPIB-488Software\National Instruments\IVI\CompliancePackage\CurrentVersionSoftware\National Instruments\IVI\IDT\2.0\CurrentVersionSOFTWARE\National Instruments\IVI Driver Library\CurrentVersionSOFTWARE\National Instruments\NI-Industrial Communications for IEC 61850\CurrentVersionSoftware\Microsoft\Internet ExplorerIEXPLORE.EXEPathListSoftware\Microsoft\Windows\CurrentVersion\App Paths\IEXPLORE.EXEInterfacespathSoftware\National Instruments\InterfacesSoftware\National Instruments\IMAQ Vision Builder\6.0Software\National Instruments\IMAQ Vision Builder\6.0JSoftware\National Instruments\IMAQ Vision Builder\6.1Software\National Instruments\IMAQ Vision Builder\[IVBVERSION]Software\National Instruments\IVI\EnginePackage\CurrentVersionInstallerVersionSOFTWARE\VXIPNP_Alliance\IVIVISACOM\CurrentVersionClientInstalledSoftware\National Instruments\Lookout\5.1Software\National Instruments\Lookout\6.0SOFTWARE\National Instruments\Lookout\6.1SOFTWARE\National Instruments\Lookout\6.2SOFTWARE\National Instruments\Lookout\6.5SOFTWARE\National Instruments\Lookout\6.6SOFTWARE\National Instruments\Lookout\6.7Software\National Instruments\Lookout\5.0DevInstalledPlayerInstalledSoftware\National Instruments\Logos\4.0Software\National Instruments\Logos\[LOGOSVERSION]Software\National Instruments\Lookout\4.0Software\National Instruments\LabVIEW\10.0Software\National Instruments\LabVIEW FF Run-Time\10.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics\10.0.0Software\National Instruments\LabVIEW Run-Time\10.0Software\National Instruments\LabVIEW\11.0Software\National Instruments\LabVIEW FF Run-Time\11.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics\11.0.0Software\National Instruments\LabVIEW Run-Time\11.0Software\National Instruments\LabVIEW\12.0Software\National Instruments\LabVIEW FF Run-Time\12.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics Module\12.0.0Software\National Instruments\LabVIEW Run-Time\12.0Software\National Instruments\LabVIEW\13.0Software\National Instruments\LabVIEW FF Run-Time\13.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics Module\13.0.0Software\National Instruments\LabVIEW Run-Time\13.0Software\National Instruments\LabVIEW\14.0Software\National Instruments\LabVIEW FF Run-Time\14.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics Module\14.0.0Software\National Instruments\LabVIEW Run-Time\14.0Software\National Instruments\LabVIEW\5.0.1Software\National Instruments\LabVIEW\5.0Software\National Instruments\LabVIEW\5.1.2Software\National Instruments\LabVIEW\5.1.1Software\National Instruments\LabVIEW\5.1Software\National Instruments\LabVIEW\6.0Software\National Instruments\LabVIEW\6.1Software\National Instruments\LabVIEW Run-Time\6.1Software\National Instruments\LabVIEW\7.0Software\National Instruments\LabVIEW Run-Time\7.0Software\National Instruments\LabVIEW\7.1Software\National Instruments\LabVIEW DSP\7.1Software\National Instruments\LabVIEW Embedded\7.1Software\National Instruments\LabVIEW Run-Time\7.1Software\National Instruments\LabVIEW\8.0SOFTWARE\National Instruments\LabVIEW FF Run-Time\8.0Software\National Instruments\LabVIEW Run-Time\8.0Software\National Instruments\LabVIEW\8.2Software\National Instruments\LabVIEW FF Run-Time\8.2Software\National Instruments\LabVIEW Run-Time\8.2Software\National Instruments\LabVIEW\8.5Software\National Instruments\LabVIEW FF Run-Time\8.5Software\National Instruments\LabVIEW Run-Time\8.5Software\National Instruments\LabVIEW\8.6Software\National Instruments\LabVIEW FF Run-Time\8.6Software\National Instruments\LabVIEW64 FF Run-Time\8.6Software\National Instruments\LabVIEW Run-Time\8.6Software\National Instruments\LabVIEW\9.0Software\National Instruments\LabVIEW FF Run-Time\9.0SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics\9.0.0Software\National Instruments\LabVIEW Run-Time\9.0Software\National Instruments\LabVIEW BrokerSoftware\National Instruments\LabVIEW\[LVVERSION]Software\National Instruments\LabVIEW\[LVVERSION64]SOFTWARE\National Instruments\LabVIEW DSCRTS\CurrentVersionSoftware\National Instruments\LabVIEW FF Run-TimeSOFTWARE\National Instruments\LabVIEW\10.0\AddOns\LabVIEW Mobile ModuleSOFTWARE\National Instruments\LabVIEW\12.0\AddOns\LabVIEW Mobile ModuleSOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA for PocketPC\7.0.0SOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA for PocketPC\7.1.0SOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA for PocketPC\8.0.0SOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA Module for Windows Mobile\8.2.0SOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA Module for Windows Mobile\8.5.0SOFTWARE\National Instruments\LabVIEW\8.6\AddOns\LabVIEW Mobile ModuleSOFTWARE\National Instruments\LabVIEW\9.0\AddOns\LabVIEW Mobile ModuleSOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW PDA for PocketPCSOFTWARE\National Instruments\LabVIEW\AddOns\Robotics Module\[LVROBOVERSION]SOFTWARE\National Instruments\LabVIEW\AddOns\Robotics\[LVROBOVERSION]SOFTWARE\National Instruments\LabVIEW\10.0\AddOns\LabVIEW Touch Panel ModuleSOFTWARE\National Instruments\LabVIEW\12.0\AddOns\LabVIEW Touch Panel ModuleSOFTWARE\National Instruments\LabVIEW\8.2\AddOns\LabVIEW Touch Panel Module for Windows CESOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW Touch Panel Module for Windows CE\8.5.0SOFTWARE\National Instruments\LabVIEW\8.6\AddOns\LabVIEW Touch Panel ModuleSOFTWARE\National Instruments\LabVIEW\9.0\AddOns\LabVIEW Touch Panel ModuleMATLABROOTSOFTWARE\MathWorks\MATLAB\6.1SOFTWARE\MathWorks\MATLAB\6.5SOFTWARE\MathWorks\MATLAB\6.0SOFTWARE\MathWorks\MATLAB\[MATLABVERSION]SOFTWARE\National Instruments\Multisim Component Evaluator\12.0\MSI Parts\ADISOFTWARE\National Instruments\Multisim Component Evaluator\13.0\MSI Parts\ADISOFTWARE\National Instruments\Measurement Studio\6.0\User InfoSoftware\National Instruments\Measurement Studio\VCNETSOFTWARE\National Instruments\Measurement Studio\7.0SOFTWARE\National Instruments\Measurement Studio\7.0\DotNETSOFTWARE\National Instruments\Measurement Studio\7.0\VCNETSoftware\National Instruments\Measurement Studio\[MEASUREMENTSTUDIOVERSION]Software\National Instruments\Measurement Studio\[MEASUREMENTSTUDIOVERSION]\User InfoSOFTWARE\National Instruments\Measurement Studio\[MEASUREMENTSTUDIOVERSION]\DotNetSoftware\National Instruments\Measurement Studio\VCSOFTWARE\National Instruments\Measurement Studio\[MEASUREMENTSTUDIOVERSION]\VCNETSOFTWARE\National Instruments\Measurement Studio\VCNETFamilyDirSOFTWARE\National Instruments\Measurement Studio\VS2005\Components\CoreSOFTWARE\National Instruments\Measurement Studio\VS2005\Components\DotNETSOFTWARE\National Instruments\Measurement Studio\VS2005SOFTWARE\National Instruments\Measurement Studio\VS2005\Components\VCNETSOFTWARE\National Instruments\Measurement Studio\VS2008\Components\CoreSOFTWARE\National Instruments\Measurement Studio\VS2008\Components\DotNETSOFTWARE\National Instruments\Measurement Studio\VS2008SOFTWARE\National Instruments\Measurement Studio\VS2008\Components\VCNETSOFTWARE\National Instruments\Measurement Studio\VS2010\Components\CoreSOFTWARE\National Instruments\Measurement Studio\VS2010\Components\DotNETSOFTWARE\National Instruments\Measurement Studio\VS2010SOFTWARE\National Instruments\Measurement Studio\VS2012\Components\CoreSOFTWARE\National Instruments\Measurement Studio\VS2012\Components\DotNETSOFTWARE\National Instruments\Measurement Studio\VS2012SOFTWARE\National Instruments\Common\Installer\MIF\MetaUninstallerSOFTWARE\National Instruments\Motion Assistant\Current VersionSOFTWARE\mozilla.org\Mozilla\[MOZILLAVERSION]\MainSOFTWARE\Microsoft\VB5CCESOFTWARE\Microsoft\DevStudio\5.0\Products\Microsoft Visual BasicSOFTWARE\Microsoft\Visual Basic\5.0SOFTWARE\Microsoft\VisualStudio\6.0\Setup\Microsoft Visual BasicSOFTWARE\Microsoft\VisualStudio\6.0\Setup\Microsoft Visual C++Software\Netscape\Netscape Navigator\[NETSCAPE4VERSION]\MainSoftware\Netscape\Netscape 6\[NETSCAPE6VERSION]\MainSoftware\Netscape\Netscape\[NETSCAPE7VERSION]\MainSoftware\Netscape\[NETSCAPESUBKEY]\[NETSCAPEVERSION]\MainPlugins DirectorySOFTWARE\National Instruments\NI-1588 Configuration\CurrentVersionSOFTWARE\National Instruments\NI-1588 Configuration 1.0\CurrentVersionSoftware\National Instruments\NI-488.2M\[NI488VERSION]OEMVersionSOFTWARE\National Instruments\NI-488.2MSOFTWARE\National Instruments\NI-845x\CurrentVersionRunKeySoftware\National Instruments\Common\Installer\MIF\MetaUninstaller\NIARPFixupSOFTWARE\National Instruments\Common\Services\CEIPSOFTWARE\National Instruments\NI-DCPower\CurrentVersionSOFTWARE\National Instruments\NI-DeviceSOFTWARE\National Instruments\NI-DMM\CurrentVersionSOFTWARE\National Instruments\NI Example FinderSOFTWARE\National Instruments\NI-FBUS\CurrentVersionSOFTWARE\National Instruments\NI-FBUS Monitor\CurrentVersionSOFTWARE\National Instruments\NI-FGEN\CurrentVersionSOFTWARE\National Instruments\NI-HSDIO\CurrentVersionSOFTWARE\National Instruments\NI-IMAQ for 1394\[NIIMAQ1394VERSION]SOFTWARE\National Instruments\NI Camera File GeneratorSoftware\National Instruments\NI-IMAQ for Windows 95/NTSOFTWARE\National Instruments\NI-IMAQdx\[NIIMAQDXVERSION]SOFTWARE\National Instruments\NI-IMAQ I/O\[NIIMAQIOVERSION]SOFTWARE\National Instruments\License ManagerSoftware\National Instruments\NI-Motion\CurrentVersionSoftware\National Instruments\MotionSOFTWARE\National Instruments\Common\Installer\MDFSoftware\National Instruments\NI PQA\CurrentVersionBinPathSOFTWARE\National Instruments\Registration\CurrentVersionSOFTWARE\National Instruments\NI-RFSA\CurrentVersionSOFTWARE\National Instruments\NI-RFSG\CurrentVersionSOFTWARE\National Instruments\NI-RIO\CurrentVersionSoftware\National Instruments\NI-Scope\CurrentVersionSoftware\National Instruments\Switch Executive\CurrentVersionSOFTWARE\National Instruments\NI Serial Software\1.42.000SOFTWARE\National Instruments\NI Serial Software\1.43.000SOFTWARE\National Instruments\NI Serial Software\1.44.000SOFTWARE\National Instruments\NI-Serial\1.45SOFTWARE\National Instruments\NI-Serial\1.5SOFTWARE\National Instruments\NI-Serial\CurrentVersionSOFTWARE\Microsoft\Windows\CurrentVersion\App Paths\serdiag.ExeSOFTWARE\National Instruments\NI-Switch\CurrentVersionSOFTWARE\National Instruments\NI-Sync\CurrentVersionSOFTWARE\National Instruments\NI-TimeSync\CurrentVersionSoftware\National Instruments\NI-TUNER\CurrentVersionSoftware\National Instruments\Update Service\CurrentVersionUpdateServiceExeSOFTWARE\National Instruments\Update Service\CurrentVersionSOFTWARE\National Instruments\Common\USI\CurrentVersionSOFTWARE\National Instruments\NI-VISA for PDA\CurrentVersionSoftware\National Instruments\VideoMASTER\CurrentVersionNIVXIPATHSoftware\National Instruments\NI-VXI for WIN32Software\National Instruments\NI-VXI for WIN32\3.0Software\National Instruments\NI-PAL\CurrentVersionSoftware\U.S. Robotics\Pilot Desktop\CoreSoftware\National Instruments\Portable ConfigurationSoftware\National Instruments\NI-5660\CurrentVersionNIRFSAVERSIONNUMERIC<200Software\National Instruments\NI-RFSA\CurrentVersionSoftware\National Instruments\RF Signal Analyzer\CurrentVersionSoftware\National Instruments\Remote System Explorer\CurrentVersionSOFTWARE\National Instruments\R Series\CurrentVersionSOFTWARE\National Instruments\LabVIEW\10.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\10.0SOFTWARE\National Instruments\LabVIEW\11.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\11.0SOFTWARE\National Instruments\LabVIEW\12.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\12.0SOFTWARE\National Instruments\LabVIEW\13.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\13.0SOFTWARE\National Instruments\LabVIEW\14.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\14.0SOFTWARE\National Instruments\LabVIEW\6.1\AddOns\Real-TimeSOFTWARE\National Instruments\LabVIEW\7.0\AddOns\Real-TimeSOFTWARE\National Instruments\LabVIEW\7.1\AddOns\Real-TimeSOFTWARE\National Instruments\LabVIEW\8.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\8.0SOFTWARE\National Instruments\LabVIEW\8.2\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\8.2SOFTWARE\National Instruments\LabVIEW\8.5\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\8.5SOFTWARE\National Instruments\LabVIEW\8.6\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\8.6SOFTWARE\National Instruments\LabVIEW\9.0\AddOns\Real-TimeSOFTWARE\National Instruments\RT Images\LabVIEW\9.0SOFTWARE\National Instruments\LabVIEW\AddOns\Real-TimeSOFTWARE\National Instruments\LabVIEW\[LVVERSION]\AddOns\Real-TimeRTVersionSOFTWARE\National Instruments\LabVIEW\[LVVERSION]SOFTWARE\National Instruments\LabVIEW\CurrentVersion5.1.2SOFTWARE\National Instruments\LabVIEW\5.1.2Software\National Instruments\RT ImagesSOFTWARE\National Instruments\LabVIEW\AddOns\Real-Time for RTX\[RTRTXVERSION]SOFTWARE\National Instruments\LabVIEW\[LVVERSION]\AddOns\Real-Time for RTXSOFTWARE\National Instruments\RTX\LabVIEWSOFTWARE\National Instruments\RT Images\LabVIEW\[RTTARGSUPPORTVERSION]RTXDirSOFTWARE\Ardence\RTXSOFTWARE\VenturCom\RTXSoftware\National Instruments\SignalExpressSoftware\National Instruments\Spectral Measurements Toolset\CurrentVersionSOFTWARE\National Instruments\NI SoftMotion\8.6SOFTWARE\National Instruments\NI SoftMotion Controller\CurrentVersionSOFTWARE\National Instruments\NI SoftMotion\CurrentVersionInstDirSoftware\National Instruments\NI SpySOFTWARE\Timken\StatusCheckSoftware\National Instruments\TestStand\3.1Software\National Instruments\TestStand\3.5Software\National Instruments\TestStand\4.0SOFTWARE\National Instruments\TestStand\4.1SOFTWARE\National Instruments\TestStand\4.1.1SOFTWARE\National Instruments\TestStand\4.2SOFTWARE\National Instruments\TestStand\4.2.1SOFTWARE\National Instruments\TestStand\4.5SOFTWARE\National Instruments\TestStand\4.5.1SOFTWARE\National Instruments\TestStand\5.0SOFTWARE\National Instruments\TestStand\5.1Software\National Instruments\TestStand\[TESTSTANDVERSION]Software\National Instruments\T&M ExplorerusiDirSOFTWARE\National Instruments\Common\USISoftware\National Instruments\Motion\ValueMotion\CurrentVersionSoftware\National Instruments\ValueMotion\CurrentVersionSOFTWARE\National Instruments\VeriStand\[VERISTANDVERSION]Software\National Instruments\VI LoggerSOFTWARE\National Instruments\NI-VISASOFTWARE\National Instruments\NI-VISA for Windows 95/NT5.0.0CVI PathSOFTWARE\National Instruments\IMAQ Vision\5.0Software\National Instruments\IMAQ VisionLV51PATHSoftware\National Instruments\IMAQ Vision\[VISIONLVCURRENTVERSION]LV60PATHLV61PATHSOFTWARE\National Instruments\IMAQ Vision for Labview\4.1.1SOFTWARE\National Instruments\IMAQ Vision for Bridgeview\4.1.1SOFTWARE\National Instruments\Volume License Manager\CurrentVersionSoftware\Microsoft\VisualStudio\10.0\Setup\VSSoftware\Microsoft\VisualStudio\11.0\Setup\VSSoftware\Microsoft\VisualStudio\7.0\Setup\VSSoftware\Microsoft\VisualStudio\7.1\Setup\VSSoftware\Microsoft\VisualStudio\8.0\Setup\VSSoftware\Microsoft\VisualStudio\9.0\Setup\VSVXIPNPPATHSoftware\VXIPNP_Alliance\VXIPNP\CurrentVersionSOFTWARE\National Instruments\NI-XNET\CurrentVersionDummyValueSOFTWARE\National Instruments\Common\InstallerDUMMYLocAUDIOMASTERDIRRegLocLocalDirectorySOFTWARE\National Instruments\BlueNITEBLUENITEDIRRegLocInstallPathCANDIRRegLocSoftware\National Instruments\Circuit Design Suite\12.0\MSI Parts\CoreCDS120DIRRegLocCRIODIRRegLocAppDataDirCVI2010PUBAPPDATADIRRegLocDocsDirCVI2010PUBDOCSDIRRegLocCVI2012PUBAPPDATADIRRegLocCVI2012PUBDOCSDIRRegLocCVI2013PUBAPPDATADIRRegLocCVI2013PUBDOCSDIRRegLocCVI850PUBAPPDATADIRRegLocCVI850PUBDOCSDIRRegLocCVI900PUBAPPDATADIRRegLocCVI900PUBDOCSDIRRegLocCVI910PUBAPPDATADIRRegLocCVI910PUBDOCSDIRRegLocSoftware\National Instruments\DASYLab\12.0DASYLAB120DIRRegLocSoftware\National Instruments\DASYLab\13.0DASYLAB130DIRRegLocSoftware\National Instruments\DASYLab\14.0DASYLAB140DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\1.0DFSE100DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\1.1DFSE110DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\3.0DFSE2011DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\3.1DFSE2012DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\3.2DFSE2013DIRRegLocSoftware\National Instruments\DataFinder Server Edition\4.0DFSE2014DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\2.0DFSE20DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\2.1DFSE21DIRRegLocSOFTWARE\National Instruments\DataFinder Server Edition\2.2DFSE22DIRRegLocSOFTWARE\National Instruments\DIAdem\11.0DIADEM110DIRRegLocSOFTWARE\National Instruments\DIAdem\11.1DIADEM111DIRRegLocSOFTWARE\National Instruments\DIAdem\11.2DIADEM112DIRRegLocSOFTWARE\National Instruments\DIAdem\11.3DIADEM2011RegLocSOFTWARE\National Instruments\DIAdem\12.0DIADEM2012DIRRegLocSOFTWARE\National Instruments\DIAdem\13.0DIADEM2013DIRRegLocSoftware\National Instruments\DIAdem\14.0DIADEM2014DIRRegLocSoftware\National Instruments\Common\InstallerDRIVERSIGNSTAGINGDIRRegLocSOFTWARE\National Instruments\Enterprise DataFinderEDFDIRRegLocCurrentPathSoftware\National Instruments\NI ELVISmxELVISMXDIRRegLocSOFTWARE\LEGO\EV3_EDU\1.0EV3EDU1DIRRegLocSOFTWARE\LEGO\EV3\1.0EV3RETAIL1DIRRegLocFIELDPOINTDIRRegLocSOFTWARE\National Instruments\NI FlexRIO\CurrentVersionFLEXRIODIRRegLocSOFTWARE\National Instruments\LabVIEW\AddOns\FPGA\[FPGAVERSION]FPGALVDIRRegLocGPIB488DIRRegLocSOFTWARE\IOtechIOTDIRRegLocSoftware\National Instruments\NI I/O TraceIOTRACEDIRRegLocLATESTMSVBDIRRegLocSOFTWARE\LEGOLEGODIRRegLocLOGOSDIRRegLocLOOKOUT50DIRRegLocLOOKOUT51DIRRegLocLOOKOUT60DIRRegLocLOOKOUT61DIRRegLocLOOKOUT62DIRRegLocLOOKOUT65DIRRegLocLOOKOUT66DIRRegLocLOOKOUT67DIRRegLocSOFTWARE\National Instruments\LabVIEW\10.0LV2010EXAMPLESDIRRegLocLV2010HELPDIRRegLocLV2010INSTRLIBDIRRegLocLV2010PALETTESDIRRegLocLV2010PLUGINSDIRRegLocLV2010PUBDOCSDIRRegLocLV2010PUBINSTRLIBDIRRegLocLV2010TEMPLATESDIRRegLocLV2010TOOLKITERRORSDIRRegLocLV2010TOOLSDIRRegLocSOFTWARE\National Instruments\LabVIEW\11.0LV2011EXAMPLESDIRRegLocLV2011HELPDIRRegLocLV2011INSTRLIBDIRRegLocLV2011PALETTESDIRRegLocLV2011PLUGINSDIRRegLocLV2011PUBDOCSDIRRegLocLV2011PUBINSTRLIBDIRRegLocLV2011TEMPLATESDIRRegLocLV2011TOOLKITERRORSDIRRegLocLV2011TOOLSDIRRegLocSOFTWARE\National Instruments\LabVIEW\12.0LV2012EXAMPLESDIRRegLocLV2012HELPDIRRegLocLV2012INSTRLIBDIRRegLocLV2012PALETTESDIRRegLocLV2012PLUGINSDIRRegLocLV2012PUBDOCSDIRRegLocLV2012PUBINSTRLIBDIRRegLocLV2012TEMPLATESDIRRegLocLV2012TOOLKITERRORSDIRRegLocLV2012TOOLSDIRRegLocSOFTWARE\National Instruments\LabVIEW\13.0LV2013EXAMPLESDIRRegLocLV2013HELPDIRRegLocLV2013INSTRLIBDIRRegLocLV2013PALETTESDIRRegLocLV2013PLUGINSDIRRegLocLV2013PUBDOCSDIRRegLocLV2013PUBINSTRLIBDIRRegLocLV2013TEMPLATESDIRRegLocLV2013TOOLKITERRORSDIRRegLocLV2013TOOLSDIRRegLocSOFTWARE\National Instruments\LabVIEW\14.0LV2014EXAMPLESDIRRegLocLV2014HELPDIRRegLocLV2014INSTRLIBDIRRegLocLV2014PALETTESDIRRegLocLV2014PLUGINSDIRRegLocLV2014PUBDOCSDIRRegLocLV2014PUBINSTRLIBDIRRegLocLV2014TEMPLATESDIRRegLocLV2014TOOLKITERRORSDIRRegLocLV2014TOOLSDIRRegLocLV86EXAMPLESDIRRegLocLV86HELPDIRRegLocLV86INSTRLIBDIRRegLocLV86PALETTESDIRRegLocLV86PLUGINSDIRRegLocLV86PUBDOCSDIRRegLocLV86PUBINSTRLIBDIRRegLocLV86TEMPLATESDIRRegLocLV86TOOLKITERRORSDIRRegLocLV86TOOLSDIRRegLocSOFTWARE\National Instruments\LabVIEW\9.0LV90EXAMPLESDIRRegLocLV90HELPDIRRegLocLV90INSTRLIBDIRRegLocLV90PALETTESDIRRegLocLV90PLUGINSDIRRegLocLV90PUBDOCSDIRRegLocLV90PUBINSTRLIBDIRRegLocLV90TEMPLATESDIRRegLocLV90TOOLKITERRORSDIRRegLocLV90TOOLSDIRRegLocLVEXAMPLESDIRRegLocSoftware\National Instruments\LabVIEW FF Run-Time\[LVFFRTEVERSION]LVFFRTEDIRRegLocSoftware\National Instruments\LabVIEW FF Run-Time\[LVFFRTEVERSION64]LVFFRTEDIR64RegLocLVDETECTED="YES" AND LVVERSIONNUMERIC>=860LVHELPDIRRegLocLVINSTRLIBDIRRegLocLVPALETTESDIRRegLocLVPUBDOCSDIRRegLocLVPUBINSTRLIBDIRRegLocLVTEMPLATESDIRRegLocLVTOOLKITERRORSDIRRegLocLVTOOLSDIRRegLocSOFTWARE\National Instruments\Measurement & Automation ExplorerMAXDIR64RegLocSOFTWARE\National Instruments\Multisim Component Evaluator\12.0\MSI Parts\CoreMCE120DIRRegLocSOFTWARE\National Instruments\Multisim Component Evaluator\13.0\MSI Parts\CoreMCE130DIRRegLocMETAUNINSTALLERDIRRegLocSOFTWARE\LEGO\Mindstorms Edu NXT\[MINDSTORMSEDUNXTVERSION]MINDSTORMSEDUNXTDIRRegLocMSTUDIOVS2003PUBAPPDATADIRRegLocMSTUDIOVS2003PUBDOCSDIRRegLocMSTUDIOVS2005PUBAPPDATADIRRegLocMSTUDIOVS2005PUBDOCSDIRRegLocMSTUDIOVS2008PUBAPPDATADIRRegLocMSTUDIOVS2008PUBDOCSDIRRegLocMSTUDIOVS2010PUBAPPDATADIRRegLocMSTUDIOVS2010PUBDOCSDIRRegLocMSTUDIOVS2012PUBAPPDATADIRRegLocMSTUDIOVS2012PUBDOCSDIRRegLocTemplatesDirectorySOFTWARE\Microsoft\Visual Basic\6.0MSVBTEMPLATESDIRRegLocVsCommonDirSOFTWARE\Microsoft\VisualStudio\6.0\SetupMSVS60COMMONDIRRegLocSOFTWARE\National Instruments\MATRIXxMTXHOMEDIRRegLocNETSCAPE4PLUGINSDIRRegLocPubDocsPathNI845XPUBDOCSDIRRegLocSOFTWARE\National Instruments\Common\Installer\MIF\CodeSignAPINICODESIGNAPIDIRRegLocNIDIRRegLocNIDIR64RegLocNIERRORSDIRRegLocNIERRORSDIR64RegLocNIEXTCOMPILERSUPPDIRRegLocSoftware\National Instruments\NI-IMAQ for Windows 95/NT\[NIIMAQVERSION]NIIMAQDIRRegLocUtilityPathSOFTWARE\National Instruments\NI-IMAQ for Windows 95/NT\[NIIMAQVERSION]NIIMAQUTILITYDIRRegLocSOFTWARE\National Instruments\IVINIIVIDIRRegLocNILEGALROOTDIRRegLocLicensesNILMLICENSESDIRRegLocLegalDirSOFTWARE\National Instruments\Common\Installer\MDF\EULAsNIMDFLEGALDIRRegLocSOFTWARE\National Instruments\Common\Installer\MDF\ManifestsNIMDFMANIFESTDIRRegLocSOFTWARE\National Instruments\Common\Installer\MIFNIMIFDIRRegLocNIPQADIRRegLocNIProductCacheDirSOFTWARE\National Instruments\Common\Installer\ProductCacheNIPRODUCTCACHEDIRRegLocNIPUBAPPDATADIRRegLocNIPUBDOCSDIRRegLocSoftware\National Instruments\NI-PXIRM\CurrentVersionNIPXIDIRRegLocNIREGWIZARDROOTDIRRegLocNIRIODIRRegLocNISHAREDDIRRegLocNISHAREDDIR64RegLocNISHAREDMEMORYDIRRegLocNIVMSDIRRegLocSOFTWARE\National Instruments\Common\Xml\XercesNIXERCESDIRRegLocInstDir64NIXERCESDIR64RegLocChassisDescriptionFilePathSoftware\PXISA\CurrentVersionPXICHASSISDIRRegLocPXIControllerPathPXICONTROLLERDIRRegLocPXIHardwareDescriptionsPathPXIHARDWAREDESCDIRRegLocModuleDescriptionFilePathPXIMODULEDIRRegLocRSERIESDIRRegLocSoftware\National Instruments\Real-Time Execution Trace Toolkit\2.0RTETT20DIRRegLocSoftware\National Instruments\RTXRTXROOTDIRRegLocSoftware\National Instruments\SignalExpress\ExamplesSEEXAMPLESDIRRegLocSoftware\National Instruments\TestStand\1.0TESTSTAND100DIRRegLocSoftware\National Instruments\TestStand\1.0.1TESTSTAND101DIRRegLocSoftware\National Instruments\TestStand\1.0.2TESTSTAND102DIRRegLocSoftware\National Instruments\TestStand\1.0.3TESTSTAND103DIRRegLocSoftware\National Instruments\TestStand\2.0TESTSTAND200DIRRegLocSoftware\National Instruments\TestStand\2.0.1TESTSTAND201DIRRegLocSoftware\National Instruments\TestStand\3.0TESTSTAND300DIRRegLocPublicLocationTESTSTAND410PUBDOCSDIRRegLocTESTSTAND411PUBDOCSDIRRegLocTESTSTAND420PUBDOCSDIRRegLocTESTSTAND421PUBDOCSDIRRegLocCustomPublicLocationTESTSTAND450PUBDOCSDIRRegLocTESTSTAND451PUBDOCSDIRRegLocTESTSTAND500PUBDOCSDIRRegLocTESTSTAND510PUBDOCSDIRRegLocSOFTWARE\National Instruments\Common\USI\2.0USI20DIRRegLocbinDirUSIBINDIRRegLocpluginDirExUSIPLUGINDIRRegLocSoftware\National Instruments\NI USRP RIO\Driver\CurrentVersionUSRPRIODIRRegLocSOFTWARE\National Instruments\VeriStand\2011VERISTAND2011DIRRegLocSOFTWARE\National Instruments\VeriStand\2012VERISTAND2012DIRRegLocSOFTWARE\National Instruments\VeriStand\2013VERISTAND2013DIRRegLocVISIONVERSIONNUMERIC>510SOFTWARE\National Instruments\IMAQ Vision\[VISIONVERSION]VISIONDIRRegLocCompatibilityModeCVICOMPATMODERegLocSchema VersionSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\d76f5121-3144-4aa9-a610-b27bff4be61aDDSVCANRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\69bce590-1d42-11d5-878e-ffffff000000DDSVCTDLRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\7a18ecd9-e03e-4203-9c73-523c58bfa171DDSVDAQRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\3e5dec80-eace-11d3-8c39-0050049fd5a6DDSVGPIBRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\0a143873-a0ea-42fc-8b19-71daca972239DDSVIMAQRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\5209604b-bf10-4684-9e80-ab0ec1416b89DDSVIMAQ1394RegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\32472105-a8f2-45e2-ae42-41f1376d0e6cDDSVIVIRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\a1491d3d-d772-4226-9a6d-b5461d4a8da3DDSVMCRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\f5dfb1cb-9975-11d4-b242-00104b37c73eDDSVSERegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\7707d690-f158-11d3-8c96-00a02416c493DDSVVISARegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\ACE5A940-4576-437F-9AE6-111A3E42E80EDDSVVLRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\378f2260-7500-4860-83f0-05bd64fb77eeDDSVVVGLRegLocSOFTWARE\National Instruments\Measurement & Automation Explorer\2.0\Storage\Data Dictionaries\1e6e7900-f157-11d3-8c96-00a02416c493DDSVVXIRegLocProductLanguageStrDIADEM101LANGRegLocProductTypeDIADEM101TYPERegLocDIADEM102LANGRegLocDIADEM102TYPERegLocDIADEM10LANGRegLocDIADEM10TYPERegLocDIADEM110LANGRegLocDIADEM110TYPERegLocSoftware\National Instruments\DIAdem\[DIADEMVERSION]DIADEMLANGRegLocDIADEMTYPERegLocSPSoftware\Microsoft\NET Framework Setup\NDP\v1.1.4322DOTNET11SPRegLocFPGA2010LANGRegLocFPGA2011LANGRegLocFPGA2012LANGRegLocFPGA2013LANGRegLocFPGA2014LANGRegLocLV2010LANGRegLocLV2010TYPERegLocLV2011LANGRegLocBuildPhaseLV2011PHASERegLocLV2011PHASE64RegLocLV2011TYPERegLocLV2012LANGRegLocLV2012PHASERegLocLV2012PHASE64RegLocLV2012TYPERegLocLV2013LANGRegLocLV2013PHASERegLocLV2013PHASE64RegLocLV2013TYPERegLocLV2014LANGRegLocLV2014PHASERegLocLV2014PHASE64RegLocLV2014TYPERegLocLV60LANGRegLocLV60TYPERegLocLV61LANGRegLocLV61TYPERegLocLV70LANGRegLocLV70TYPERegLocLV71LANGRegLocLV71TYPERegLocLV80LANGRegLocLV80TYPERegLocLV82LANGRegLocLV82TYPERegLocLV85LANGRegLocLV85TYPERegLocLV86LANGRegLocLV86TYPERegLocLV90LANGRegLocLV90TYPERegLocLVLANGRegLocLVLANG64RegLocLVTYPERegLocLVTYPE64RegLocUninstallStringSoftware\Microsoft\Windows\CurrentVersion\Uninstall\MAXMAX1UNINSTALLRegLocDisableOEMArpShowPreCAMETAUNINSTALLERDISABLEOEMARPPRECARegLocEXENameMETAUNINSTALLEREXENAMERegLocSoftware\Netscape\NetscapeNETSCAPESUBKEYRegLocSoftware\Netscape\Netscape 6Software\Netscape\Netscape NavigatorRunCommandNIARPFIXRUNCOMMANDRegLocDllNameNICODESIGNAPIDLLNAMERegLocNIDEVICEOEMVERSIONRegLocExecutableNameNILMEXENAMERegLocPeripheralModuleDriverPathSOFTWARE\National Instruments\NI-PXIRM\CurrentVersionNIPXIEPERIPHERALDRIVERDLLRegLocNIREGWIZARDEXENAMERegLocUpdateServiceExeNameNIUPDATESERVICEEXENAMERegLocCmdLineTool1PORTCFGCMDLINETOOL1RegLocTaskCreate1PORTCFGTASKCREATE1RegLocRT2010LANGRegLocRT2011LANGRegLocRT2012LANGRegLocRT2013LANGRegLocRT2014LANGRegLocVILOGGERTYPERegLocCVIVersionAMTCVIVERSIONRegLocLabVIEWVersionAMTLVVERSIONRegLocAWEVERSIONRegLocBVVERSIONRegLocCALEXECVERSIONRegLocCDS120COREVERSIONRegLocCDS130COREVERSIONRegLocCRIOVERSIONNUMERICRegLocCVIRT2010TARGSUPPORTVERSIONRegLocCVIRT2012TARGSUPPORTVERSIONRegLocCVIRT2013TARGSUPPORTVERSIONRegLocCVIRT80TARGSUPPORTVERSIONRegLocCVIRT81TARGSUPPORTVERSIONRegLocCVIRT85TARGSUPPORTVERSIONRegLocCVIRT90TARGSUPPORTVERSIONRegLocCVIRT91TARGSUPPORTVERSIONRegLocSOFTWARE\National Instruments\RT Images\CVI\[CVIRTTARGSUPPORTVERSION]CVIRTTARGSUPPORTVERSIONNUMERICRegLocSOFTWARE\National Instruments\CVI\[CVIVERSION]CVIVERSIONNUMERICRegLocSoftware\National Instruments\CVICVIVERSIONRegLocDAQMXBASEVERSIONRegLocDAQMXVERSIONRegLocDIADEM10VERSIONRegLocSOFTWARE\National Instruments\DIAdemDIADEMVERSIONRegLocDMTCVIVERSIONRegLocDMTLVVERSIONRegLocDNETVERSIONRegLocELVISVERSIONNUMERICRegLocSoftware\National Instruments\FieldPointFIELDPOINTVERSIONPrivateRegLocFIELDPOINTVERSIONRegLocSOFTWARE\Mozilla\Mozilla FirefoxFIREFOXVERSIONRegLocFLEXMOTIONVERSIONRegLocSoftware\National Instruments\IMAQ Vision BuilderIVBVERSIONRegLoc4.0LATESTDOTNETVERSIONRegLoc3.53.02.06LATESTMSVBVERSIONRegLoc5SOFTWARE\National Instruments\Logos\CurrentVersionLOGOSVERSIONRegLocLV2010VERSIONRegLocLV2011VERSIONRegLocLV2012VERSIONRegLocLV2013VERSIONRegLocLV2014VERSIONRegLocLV60VERSIONRegLocLV61VERSIONRegLocLV71DSPVERSIONRegLocLV71EMBVERSIONRegLocLV71VERSIONRegLocLV7VERSIONRegLocLV80VERSIONRegLocLV82VERSIONRegLocLV85VERSIONRegLocLV86VERSIONRegLocLV90VERSIONRegLocLVDSCRTSVERSIONRegLocSOFTWARE\National Instruments\LabVIEW\AddOns\LabVIEW Mobile ModuleLVMOBILEVERSIONRegLocSOFTWARE\National Instruments\LabVIEW\AddOns\Robotics ModuleLVROBOVERSIONRegLocSOFTWARE\National Instruments\LabVIEW\AddOns\RoboticsSOFTWARE\National Instruments\LabVIEW Run-TimeLVRTEVERSION64RegLocLVRTEVERSIONRegLocSoftware\National Instruments\LabVIEWLVVERSION64RegLocLVVERSIONRegLocSOFTWARE\MathWorks\MATLABMATLABVERSIONRegLocSoftware\National Instruments\Measurement & Automation ExplorerMAXVERSIONRegLocMCE120COREVERSIONRegLocMCE130COREVERSIONRegLocFullInstallVerSOFTWARE\Microsoft\DataAccessMDACVERSIONNUMERICRegLocMEASUREMENTSTUDIO70VERSIONRegLocSoftware\National Instruments\Measurement StudioMEASUREMENTSTUDIOVERSIONRegLocMEASUREMENTSTUDIOVS2005COREVERSIONNUMERICRegLocMEASUREMENTSTUDIOVS2008COREVERSIONNUMERICRegLocMEASUREMENTSTUDIOVS2010COREVERSIONNUMERICRegLocMEASUREMENTSTUDIOVS2012COREVERSIONNUMERICRegLocSOFTWARE\LEGO\Mindstorms Edu NXTMINDSTORMSEDUNXTVERSIONRegLocMOTIONASSISTANTVERSIONRegLocSOFTWARE\mozilla.org\MozillaMOZILLAVERSIONRegLocCurrentMxsVersionMXSVERSIONRegLocNETSCAPE4VERSIONRegLocNETSCAPE6VERSIONRegLocNETSCAPE7VERSIONRegLocSoftware\Netscape\[NETSCAPESUBKEY]NETSCAPEVERSIONRegLocSoftware\National Instruments\NI-488.2MNI488VERSIONRegLocNICEIPVERSIONRegLocNICODESIGNAPIVERSIONRegLocNIDAQVERSIONRegLocNIDEVICEVERSIONRegLocNIEXFINDER10VERSIONRegLocBinFileVersionNIEXFINDERBINVERSIONRegLocNIFBUSMONVERSIONRegLocNIFBUSVERSIONRegLocSOFTWARE\National Instruments\NI-IMAQ for 1394NIIMAQ1394VERSIONRegLocSOFTWARE\National Instruments\NI-IMAQdxNIIMAQDXVERSIONRegLocSOFTWARE\National Instruments\NI-IMAQ I/ONIIMAQIOVERSIONRegLocSoftware\National Instruments\IVI\CurrentVersionNIIVIVERSIONRegLocNILMVERSIONRegLocNIMCVERSIONRegLocSOFTWARE\National Instruments\Common\Installer\MDF\BinNIMDFBINDIRRegLocNIMDFVERSIONRegLocNIREGWIZARDVERSIONRegLocNIRFSGVERSIONRegLocNISCOPEVERSIONRegLocNISERIALVERSIONRegLocNISEVERSIONRegLocNITUNERVERSIONRegLocNIUPDATESERVICEVERSIONNUMERICRegLocNIUPDATESERVICEVERSIONRegLocNIVISAVERSIONRegLocCurrentversionNIVXIVERSIONRegLocPORTCFGVERSIONRegLocRFSIGNALANALYZERVERSIONRegLocRSERIESVERSIONNUMERICRegLocRT80TARGSUPPORTVERSIONRegLocRT82TARGSUPPORTVERSIONRegLocRTRTXTARGSUPPORTVERSIONRegLocSOFTWARE\National Instruments\LabVIEW\AddOns\Real-Time for RTXRTRTXVERSIONRegLocSOFTWARE\National Instruments\RT Images\LabVIEWRTTARGSUPPORTVERSIONRegLocRTXENGINEVERSIONRegLocSEVERSIONRegLocSMTVERSIONRegLocSOFTMOTION86VERSIONNUMERICRegLocSOFTMOTION86VERSIONRegLocSOFTMOTIONSDKVERSIONRegLocSOFTMOTIONVERSIONRegLocSOFTWARE\National Instruments\LabVIEW\7.1\AddOns\Signal Processing ToolsetSPTLV71VERSIONRegLocSOFTWARE\National Instruments\LabVIEW\[LVVERSION]\AddOns\Signal Processing ToolsetSPTLVVERSIONRegLocSoftware\National Instruments\TestStandTESTSTANDVERSIONRegLocVALUEMOTIONVERSIONRegLocSOFTWARE\National Instruments\VeriStandVERISTANDVERSIONRegLocProduct VersionVILOGGERVERSIONRegLocSOFTWARE\National Instruments\IMAQ Vision\CurrentVersionVISIONLVCURRENTVERSIONRegLocSoftware\National Instruments\IMAQ Vision\CurrentVersionVISIONLVVERSIONRegLoc4.1.1VLMVERSIONRegLocEnvVersionSoftware\Microsoft\VisualStudio\7.0\SplashInfoVSNET70VERSIONRegLocSoftware\Microsoft\VisualStudio\7.1\SplashInfoVSNET71VERSIONRegLocMicrosoft ActiveSyncCVILabVIEWAudioM~AudioMASTERNIAnalog~1Assist~1AssistantsCBuild~1CBuilder4BorlandCBuilder5BlueNITEBRIDGE~1BridgeVIEW 2.1CalExecCalibration ExecutiveCDS101CDS110Condit~1cRIOCompactRIOCVI2010CVI2012CVI2013CVI400CVI401CVI500CVI550MStudioMeasurementStudioCVI70CVI71CVI80CVI81CVI85CVI90CVI2009CVIVERSIONNUMERIC<820 AND NOT CVIINCLUDEDDAQmxB~NI-DAQmx Base DASYLab 12.0DASYLab 13.0DASYLab 14.0DSocketDataSocketDFer~r10DataFinder Server Edition 1.0DFe~r101DataFinder Server Edition 1.1DFe~2011DataFinder Server Edition 2011DFe~2012DataFinder Server Edition 2012DFe~2013DataFinder Server Edition 2013DataFinder Server Edition 2014DataF~2DataFinder Server Edition 2.0DataF~21DataFinder Server Edition 2.1DaF~2010DataFinder Server Edition 2010DIAdm101DIAdm102DIAdem 10.2DIAdem10DIAdm110DIAdem 11.0DIAdm111DIAdem 11.1DAdm2010DIAdem 2010DAdm2011DIAdem 2011DAdm2012DIAdem 2012DAdm2013DIAdem 2013DIAdem 2014DIAdemModula~1ModulationFramewrkFrameworkMSoft.NETMicrosoft.NETFra~64Framework64SignDvrsSigned DriversNI-PALEntDF~1Enterprise DataFinder 1.0ELVISmxEV3EDUMINDSTORMS Edu EV3LEGOSof~LEGO SoftwareEV3MINDSTORMS EV3FIELDP~1Mozill~1Mozilla FirefoxPluginsFMotionFlexMotionNI-Mot~1FlexRIONI FlexRIOReqGateRequirements Gateway 1.0R~G~1.1Requirements Gateway 1.1R~G~2012Requirements Gateway 2012INTERN~1PLUGINSInterf~1InterfacesIOtechNI IO TraceIVB60IMAQ Vision Builder 6IVB60JIMAQ Vision Builder 6JIVB61IVBIVIF~nIVI FoundationVB98Micros~1Microsoft Visual StudioLogos400SharedLooko400Looko500Lookou~1.1Looko600Looko610Loo~6.2Loo~6.5Loo~6.6LV2010LabVIEW 2010examples2010LVRTELabVIEW Run-Timehelpinstrlibinstr.libmenuspluginsprojectuser.libtemplateserrorsLV2011LabVIEW 20112011LV2012LabVIEW 20122012LV2013LabVIEW 20132013LV2014LabVIEW 20142014LView500LabVIEW 5LabVIEW6LabVIEW 6LView616.1LabVIEW77.0LabVIEW71LV71DSPLabVIEW 7.1 DSPLV71EMB7.1LabVIEW808.0LV828.2LV858.5LV86LabVIEW 8.6example8.6temp~templateLV2009LabVIEW 20092009LVBrokerLabVIEW BrokerLvDscRts800instrDrvinstrument driverspalettesLabVIEW (32-bit)LVDETECTED="YES" AND LVVERSIONNUMERIC>=870toolsMATLAB~1MATLAB6p1MATLAB6p5matlab~1matlabR12MAXINIVCNETMeasurementStudioVS2003DotNETVCMeasurementStudioVS2005MeasurementStudioVS2008MeasurementStudioVS2010MeasurementStudioVS2012NIUninstNIUninstallerLMEduNXTLEGO MINDSTORMS Edu NXTMAssistMotion Assistantmozilla.orgMS2003MEASUREMENTSTUDIOVS2003DETECTED="NO" OR MEASUREMENTSTUDIOVS2003VERSIONNUMERIC>=811MStudioVS2003MS2005MEASUREMENTSTUDIOVS2005COREDETECTED="NO" OR MEASUREMENTSTUDIOVS2005COREVERSIONNUMERIC>=811MStudioVS2005MS2008MStudioVS2008MS2010MStudioVS2010MS2012MStudioVS2012VC98CommonMATRIXxCommun~1CommunicatorProgramNetsca~1Netscape 6NetscapeNI-488.2NI-845xNI-985xCEIPCODESI~1.DLLCodeSignAPIMIFNIDeviceDriver DeploymentMapsErrors1.0Exampl~1Example FinderExtComSu~ExternalCompilerSupportNI-FBUSMonitorIMAQ1394NI-IMAQ for IEEE-1394CamCfgIMAQdxNIIMAQIONI-IMAQ IOUtilityIVI_Legal InformationBinLicens~1VersionNT >= 600BinRTEMDFlicenseLegalMFTManifestsniorbNIPQANI PQAPRODCACHProductCachePXIRegist~1RegistrationWizardSwExecSwitch ExecutiveniserialNISerialLVHelp~LV Help IndexShdMemShared MemoryNI-TUNERU~ServiceUpdate ServiceVidMSTRVideoMASTERNIVXIAPINIVXI APIVXIXercesXmlpalmOnePortCfgPortable ConfigurationChassisDescriptionsContro~1ControllersHardwa~1Hardware DescriptionsModulesPXISARFSgNlzrRF Signal AnalyzerRmSysExpRSERIESR SeriesRTETT20RTImagesRT ImagesRTXRTXRootSignal~1ExamplesSpectralNISo~86NI SoftMotion 8.6NISoftMnNI SoftMotion ControllerNISMSDKNI-SoftMotion SDKNISpyStatus~1StatusCheckTimkenTStnd100TestStand 1.0TStnd101TestStand 1.0.1TStnd102TestStand 1.0.2TStnd103TestStand 1.0.3TStnd200TestStand 2.0TStnd201TestStand 2.0.1TStnd300TestStand 3.0TStnd310TestStand 3.1TStnd350TestStand 3.5TStnd400TestStand 4.0 TStand41TestStand 4.1TStnd411TestStand 4.1.1TStnd42TestStand 4.2TStnd421TestStand 4.2.1TStnd450TestStand 2010TStnd451TestStand 2010 SP1TStnd500TestStand 2012TestStand 2013TStandTestStandTMExpTest and Measurement ExplorerUSIbinNIUSRP~1NI USRP RIOVMotionValueMotionVcomVenturcomVeriStand 2011VeriStand 2012VeriStand 2013VILoggerVI LoggerVISAWinNTWin64VisionUNKNOWNVLMMSVS10Microsoft Visual Studio 10MSVS11Microsoft Visual Studio 11VSNETMicrosoft Visual Studio .NETVSNET03Microsoft Visual Studio .NET 2003MSVS8Microsoft Visual Studio 8MSVS9Microsoft Visual Studio 9=-*NIEXTCCOMPILERSUPP{C5D31307-99BF-492E-B6F8-2EDB70943B79}Really only need to open on 2000\XP, but doing so on all for consistency and future compatibilityNeed to open on all OSesGrant everyone full access to NIPUBAPPDATADIR\Shared MemoryD:(A;CIOI;FA;;;WD)Msvc4294967295ENGLISHTDMEnglishNone6.0.0600uninst.exeCodeSignAPI64.dllCodeSignAPI.dllnilmUtil.exe[NIPXIDIR]Drivers\NIPXIePMu.dllRegistrationWizard.exeNIUpdateService.exenipcrunw.exenipctaskcreate.exeNONE510610ALLUSERSARPNOREMOVEARPNOREPAIRARPSYSTEMCOMPONENThttp://www.ni.com/support/ARPURLINFOABOUTARPHELPLINK34UniquifiedLOWERVERSIONDETECTED.LVRT.NBFIFO.2013HIGHERVERSIONDETECTED.LVRT.NBFIFO.2013 AND NOT NIRUNNINGINMERGEDHIGHERVERSIONDETECTED.LVRT.NBFIFO.2013;LOWERVERSIONDETECTED.LVRT.NBFIFO.2013ApplicationUsers.LVRT.NBFIFO.2013Accept.LVRT.NBFIFO.2013Accept.LVRT.NBFIFO.2013 = "Yes"[ReinstallRepair.LVRT.NBFIFO.2013][Reinstal lFilePresent][ReinstallFileOlderVersion.LVRT.NBFIFO.2013][ReinstallFileDifferingVersion][ReinstallFileChecksum][ReinstallFileForceAll][ReinstallUserData][ReinstallMachineData][ReinstallShortcut]InstallMode.LVRT.NBFIFO.2013 = "Custom" AND NOT Installed AND NOT RESUME AND NOT PreselectedLVRT_00_downgrade_check.LVRT.NBFIFO.2013LVRT_00\LVRT_00_jpn.mstLVRT_00\LVRT_00_deu.mstLVRT_00\LVRT_00_kor.mstLVRT_00\LVRT_00_chs.mstLVRT_00\LVRT_NBFifo_2013.msiLVRT_00\LVRT_00.cabLVRT_00\NI LabVIEW 2012 Real-Time NBFifo [13.0.336]\NIProductBuilderVersionNINOTI~1.5CA|NI LabVIEW 2012 Real-Time NBFifo 13.0.336 {EEDB0927-3BD8-4349-856E-425A146CC680}NIProductNoticesDirNINOTI~1.5CA|notice.txtNINoticeFile.5CAF7977_0198_4406_ADED_44A6526B668BNINoticeFileFileId.5CAF7977_0198_4406_ADED_44A6526B668B{5CAF7977-0198-4406-ADED-44A6526B668B}NINoticeFileComponentKeyFile_MsiFileHashOptionsHashPart1HashPart2HashPart3HashPart4NIMDFM~1.5CA|NI LabVIEW 2012 Real-Time NBFifo {EEDB0927-3BD8-4349-856E-425A146CC680}.xmlNIMDFManifest.5CAF7978_0198_4406_ADED_44A6526B668BNIMDFManifestFileId.5CAF7978_0198_4406_ADED_44A6526B668B{5CAF7978-0198-4406-ADED-44A6526B668B}NIMDFManifestDirComponentKeyLVRT_NBFifo_2013_mft.cabLVRT_00\LVRT_NBFifo_2013_mft.cabmKVwyTmba@(-D?FN#CLH4%2dvu x&JfCW.t8J5C?YRMOHdd_N )   $ O   I+]+V  %  ''++<"!2!-FmKVwyTmba@(-D?FN#CLH4%2dvu x&JfCW.t8J5C?YRMOHdd_NP^oXZxsyjnpsy    $      & $      &!     &!   !  /( )  !&     &&%" 6 O ! g K 0   `h    F K# p0(()3  GI & 8:A  Y  Gn    Pb #  :E* :;    B J+@   8   60GPA>TFO!"G | (( ! E    #  "  % %$ -66 P* W--' c 1lY\3   Yf"T67-$64 4 / '  (, L    ^&,'(( @       *   $       <,7    5.-(               Z3:+++ +   &&  &&& , #  {#}% # &&   K9.:> kQC@Tj';~~`# `85dXV/0O=R=sq./N[BQ|3$(*!?n67DdT76f#7)8 8fBoz{ra_5<6RK pg}HHrn!s9c%A?vJ;>'>0 6$  0 1-.G+;$0>=:C :M?9B82 ,  F " 68<>   '         ^S. :"= # =2 #$s/8 1          4*)    ,      K    n    1 6.J = 0## '&T+1T 2     +  fuG9  ?           f ' '# + ) !   ,c"$  8   9       0) /   ()   #"   /*                n   B?  " " "            1 ! )(         "  32' ' ' ' . ' . ' . ' ' '                      ( !  (   $ ,  * % 5   '  -   +              "  1    '       *:     #      :A%                            # $    %"  ! $   #  #$   >  %"  ! $   #  #$   >  %"/  ! $   #  #$   >  %"/ ! $   #  #$   >  %"/  ! $   #         "    "    "     "      "     "     "       "        " #   !   #    "     (   <  4  ."  % 0 ""!"  <!  43 <   --        % ? 0   01! !  !! !.)% !% '$%#")% !% "$#")% !% "$#")% !% #")% !% ;! + *^([%f(c%f(c%f(c%f(c%        P6    ! K/ ! / ! /0$ H=SPB   # **          )             " K         & )  # )& &$  &           (  )#!!   $    '  . &    ! -$"  %                 %         #  + / %   /0()    ( -.               > %  U  !#    HHH=+        # 7                                       !"! &$&&%$&&%$&&$&&            b &Y   888807 :33FFEEEEFEE78&&&''%%%%%%%%%%.7070706/6/6/6/6/?+53:5(=W)))4Z04R,,, 5/- 2  5 EC6>76666655555551666B8?W$ @(565>>2 ))))))))  '2)*6<3*6<3*6C3*6C3*6C3+)++)))2)2)-22)52)52)52)572)5;2,13;1GGKKKXXFFELELLZ\KK )MM>64;:KUR3Q6 GI7HGI7HGI7GI7B>2@#@><429BF6 '4M27'3/4<45B679;-6$2394435=999,+6?6485;;7<8 .23)444?C5;4;4;4;4;4::::3:3:3:3:36B 1 4+'MJ)F+J/E:$++++-+-+-++:*(?8:'%7-)B;>C--,,,, .4 .L&  F   ***;;;;;;;;;))))))). 3  (7? *  * * * * * ) BD* ?NN:     # )% >  G G!8<2;5/ C!4+---+-+, ?,,,9         44   7'$ 5   !!!E$.!$( 12B<5.%? 0//// "'.')06#>/ JR''88 ..       )           ! & - 6 9 > E H M T W \ e f h i n o q r t u z { } ~         9 9 ; ; G G J J L L ` c f j n p s ~            " % & * + / 0 3 6 7 : < E G I N P U W ] b d o w y {        ! # & ( 4 9 > C F I L O R U [ ] g m )03=@BEGIKMOQTW[_acgikoqswy{  _____c#Ke___aBBKH_WW_gl____e_KKL<>LI<><><><><><><>I<>bd<>IIII  F H IF H F H F H F H F H F H F H IF H m o F H  I I e f Ie f e f e f e f e f e f e f Ie f e f  I I KL9 I9  L  n #          KW __% _* _/ _6 6 d I E d N d U d ] _K K KLK L K    K K  K KKK& ! K K L _K c# _@KL! l_______`&&   & &%%@Q^!" $'&)+-/12357;;><%)+-/135JJKKLNL@OOQQRRSSTTUUQQLLVVWWTTYYKKZZOOQQRRSSTTUUQQZZVVWWTT\\KK]]OOQQRRSSTTUUQQ]]VVWWTT__KK``OOQQRRSSTTUUQQ`VVWWTTbbKKccOOQQRRSSTTUUQQccVVWWTTeg i k n$ p4 rrC ttR vvxxKKzzOOQQRRSSTTUUQQzzVVWWTT~~KKOOQQRRSSUUQQVVWWTT KKrrOQRSUQVVWWTh }  "><><><>""""  & 33 @2 7 < S S S     ; "$&(***,,,...0002224446667779;<1=<=<"??ACDEFHI&I&JKLMMMMPRTVXZ`  %% @ "%#&(*,./024689::=<?ABCDEFGHIIKKLML@OOPPRRSSTTUUPPLLVVWWTTXXKKZZOOPPRRSSTTUUPPZZVVWWTT[[KK]]OOPPRRSSTTUUPP]]VVWWTT^^KK``OOPPRRSSTTUUPP`VVWWTTaaKKccOOPPRRSSTTUUPPccVVWWTTdfhijklmopqrrsttuvvwwyyzzOOPPRRSSTTUUPPzz{|WWTT}}KKOOPPRRSSUUPPVVWWTTKKrOQRSUQ||WWTh  "=<=<=<="""" 33@2 7 <     !#%')))+++---///1113335558:<1=<=<">>@BGIIJKLMMMMNOQSUWYFM&NM%&&''Q()SAM+,U15V7@XZ8[\9]^:;<=>?@ABC_`DabEcdFMFMFMZ'Z\]fhj^lnprrttvvxz|abc~defghMqqqMFuM7vMMMGMMMMMMMMMMMMMMMMMMMMMM        MM !MM M!"M$&#M((;%*MM()M,M,*M-.12,45/1M2MM644MMM87M9M<?MCD:<E>?EEEEEEMHIJIPOMKMMRSMPMTRVTUWYos[t]vyz{|M}_acegik~MmMnMoMpMrMsMtMuMwyMyM{}}MMM p B  ECL><B@KHKPNTR\Z`^dbhfljvtzx~|          ( & , * 0 . 4 2 H F L J T R X V \ Z d b k i o m s q w u %   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsttuvvwxyz{|}~      !"##$%&'()*+,-./0123456777789:;<=>?@ABCDEEFGHIJKLMNOPQRSTTTUVWXYZ[\]^_`abcdefghijklmnnnnnnoppqrsstuvwxyz{|}~MNQSUVXZ[\]^_`abcdfhjlnprtvxz|~    !#%&'()*,/12479;<?@ACDEFGHIKMPRTVWY[]_acegikmnoprstuwy{}      !"#$&'')***,....33336789:;<=>?@ABCDEFGIKKNOQRTVVWX[\^_`abdegiijklnpqrstuwxy{}     !"%'()*+,.012345670123456701234567:;<=>?@ABCDEFGHIJKLMNOPQRSTURVWXYZ[\]^_`abcdefghijklmnopqrsttuvwxyz{|}~        !"#$%&'()*+,-.01234569:<<<<?@ABCDEFGIJJLPTegikmoqsuwy{};7770123456hhhhhhhhhhLL  $+.068:>BLJJOBBOXZ\^`bdfhj%&'()*+,v00|~}} ==AAEEIIMMVVWWYY[[__bbeehhllqrqr$4T%%(  +5=AEIMVW\][Y_behlsHJLMMPPSUU Z]cfUUmo$z|~6124<?@A &-////////8888888899999999""       /8;=>HKORWYWYWYWYWYWYJ89/    9 ; G J L     9 ; G J L     9 ; G J L     9 ; G J L     9 ; G J L     9 ; G J L     9 ; G J L   K  9 ; G KJ L WYWYWYWYWY" - 35=KL] LNQSUllllqqqqxz,,,,,,,,,,,,,,,,,,,,,,,,,,Yhv$#7-/0124447" $ & ( * , . 0 2 4 > N P R T V X _ b e i x  $ ) . 5 C L S Z _ j m q u }   * / 3 8 = B E H K N Q T _ c d f k q w y   "'/2<?SVY]emu}  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'(()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%    "#$'(*+-.013468:;=?ABDFHJKNQSUVWY[\]_abceghikmnoqstuwyz{}    "#$&')*+-/13579;=?ABCEGHJKNPRTVWY\]_abcdfgiklmoprtvxz|~   !$&'(*,.02468:<>@BDFHIKLNPRTVXZ\^`bdfhjlnprtvxz|~             " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f g i k m o q s u w y { }                  ! " # % & ' ( * , - / 0 1 2 3 5 6 8 9 ; = > @ A B D E G H J L M O P Q S T V W Y [ \ ^ _ ` b c e f h i k l n o q r t u w x z { } ~                " $ & ( * , . 0 2 4 5 6 9 ; < > A B C D G J L N P R T V X Z [ \ ] _ ` b c e f g i j k m n p s u v x z | ~           " $ % & ) * + . / 0 3 5 6 7 : < > @ A C E G I J L N P Q S U W Z ] _ b d f h j k m o q r s u w y { }                 ! # % & ( * + , - / 0 1 3 4 5 6 8 9 : ; = > ? @ B C E F H I K L N O Q R T U V W X Y [ ] _ ` a c d f g h i k m o q s u w y z { } ~      "#$%')+-/02345679:<=?@BEGIKMOQSTVWY[]_acegikmoqsuwy{}    ~   !%!&&)),,//225799<>@@CEIMPRTTTXZZZ^```dfffjlllprrrvxxx|~~~  !!!%%(%%,.02468:<>@@@DFLIMOQSUZX[^^^^^eeehjnjjjqsuwy{}  #%%)+-/13579;=?ACEGIJ MOQSUWY[]_acegikmoqsuwy{}              ! # % ' ) + - / 1 3 5 7 9 ; = ? A C E G I K M O Q S U W Y [ ] _ a c e e h j l n p r t v x z |                    $ $ $ $ ) + + .     4 4 7 7 : < < ? 4 4 C C F F I K K N C C R R U U X Z Z ] R R a c d f g i j l m o p r s u v x y { | ~                  ! # % ' ) + - / 1 3 3 3 8 : ? = @ B @ D F I K M O Q S U W Y [ ] ^ ^ a a d d h h h h l q o r t t w y { } w y { % %% %         ! # ' # ( , ( - 1 - 2 4 8 4 9 ; = ? B B B B B K K K K R R R R Y \ ^ a c e g i l l l p p l t v x z | ~  n             " $ ) ' ) ) ) ) . . . 2 2 2 2 7 7 7 7 < < < < A A D D G G J J M M P P S S S S A A Z \ ^ ^ ^ b b e e e e j l n p r t v x x x | |        !!&(*,..1111..88;;>CADFHJLNPRRUUXZ\^`bdfhjlnprtvxz|~   #HHLOHHHH   BBKHWW]`]]ddglK "<>LI<><><><><><><>I<>bd<>IIII  F H IF H F H F H F H F H F H F H IF H m o F H  I I e f Ie f e f e f e f e f e f e f Ie f e f  I I KL     7  < E H E g g n #         K           % * / 6 6 A D F H J M O Q T V X [ X ` f k n K K KLK L K  K K  K KK# K& ! K K L K # 1 1 1     @KL! lGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGdd ?g////g/g/g/FVV %%%3HGJGJUTGdjGJGJGJ  """""""%+++++++////////////55....;;ggggggggggpp"""((((999>>>>>>>>>SSSUUUUbbbbb~~**VVV         !!#######$$$$((((((((*******,,,,00003333;;;;;@@@@@GGGGGIIIJJJJJJJJJJTTTTTTTTYYYY^^^^^^^^ggggggggkkkkknnpppqqqrrrsttvvwwwyzz{{{{{{{{{ ! #$%&'( $&',-. /012345678556?5 34ghijkl6qq0"#$0:1234568?:0V_bijk:: ,: :+,,5 #&Y   $A  6 Y   ?    :g $%&'(%&'$A)+V-./51 579 9>$D #5KqMNOPRS,KVWX Z[ .begi .begiKlmo:KKu>x1-.|}~"2222"2""2""2"22"2"""""2222"""2222""2""""""2222"""2"""222""""""222"2"2"""2""""2""2222"2"""""2"2"""""22""2"2""""""22"""2"22"2""22"""""2"""2"222"2"2""222222"""""""22""""""""2"""""""22"""""""""22222"222""""""2"""2""2222"22"22222222222222""2""""""2""""2""""""2"""""""""""2"2"""""2"2""2"""""""2"2""2"2"""2"2222""2"2222"222"2222""2"2""22"22"""""""2"2"2"2"2""""22"""2"222"2""""22""""""2222"2""2222"2"""22""2"2"""""""""""""2"222"""2""22666 66,6666665$666,:66666,6666666666666LR"FLQ]]HI354     !"#$%& '().,0/-2167?>9@8;<=CDEABGJUKMNOPQST2468:<8=A?EBC\_`acfh\_`acfh[+3Xޫ@EkI)C NU>SUb~'{5CAF7976-0198-4406-ADED-44A6526B668B}@ tAn@ tAn1Windows Installer XML v2.0.4415.0 (candle/light)$A8B ;<=ikmoMZ@  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !L!This program cannot be run in DOS mode. $ɦߓȌȌȌLȌZȌ\ȌYȌRichȌPELQ!   @ 04 .textY `.rdata @@.rsrc40@@U] U]U]U3]U3]U3]Qp Qf H T ` 0@Pv ~ NIPathsStub.dllNIPathsNIPathsRemoveBackslashSaveDirsToRegRSDS?,H=ldc:\P4\NIInstallers\trunk\3.2\src\MetaUtils\NI-PathsStub\Unicode_Release\NIPathsStub.pdb 8Ph  083Z84VS_VERSION_INFOon_StringFileInfox040904b0JCompanyNameodNational Instruments=CXFileDescriptionmeNI-Paths Dummy Stub DLL4 FileVersionPr3.2.0.351DInternalNameNI-Paths Stub DLL|,LegalCopyrightCopyright 2006-2013. All Rights Reserved.HOriginalFilenameNIPathsStub.dllPProductNameFiNI-Paths Dummy Stub DLL0ProductVersion3.2.0@VarFileInfoos TranslationL PAPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADIi)XY      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  MZ@ !L!This program cannot be run in DOS mode. $cP` P` P` YO` Y` wvG` P` ` Y<` YQ` N2Q` YQ` RichP` PELQ!  LX9`*q:/, 0|F@.text `.rdata߀@@.dataP(@.rsrc0 @@.relocvxz@BT$ VvL$ D$f0f;1uu3^f;^@VD$Px^VjhP^VD$t V^̋L$T$Vt$Wr;ustD9+u1v5By+u v$By+uvBI+_^_3^QVjL$ Fs@FL$^YQVWjL$ Gv sHGw֍L$#_^YQW9t?jL$Gv sHGVw֍L$#t j^_YSUl$ W;;}tdjL$.Gv sHGVw֍L$#1t jҋujL$3Fs@FL$^_][D$Vt V ^̋T$@8R@̋T$@8R̋T$@8R3Ʌ̋T$@8R3Ʌ̋T$@8R3Ʌ̋T$@8R3Ʌ3f9AD$Vt V ^VtP^VtP^̸ ̃43ĉD$0S\$u Fxt^ Hyuxu IȋxtN^Ë@xuN;HuFЋBxtF^̋D$V(HNWxjL$~TGs@GL$ g_^QVW(F@FjL$ Gs@GL$_^Y̍A̋P̋P̋@(̋P,̋@0VL$tPҋ^̋ tP̋Ã̃ VWtVP ҃vJPҋu'jhPL$hD$ PD$ BЋBЉ7_^ 3ɸЃ  Q2u'jhPL$6hD$PD$ fL$f ̋@8̋D$VL$QF VHN PV@ FFV^̋D$QPfD$̋D$ T$QL$ PQR Ul$Vt$W;tS\$PBSЄu;u[_^] Ul$Vt$W;tS\$PBSЄt;u[_^] ̋D$QPS\$ Vt$ ;tWyWPf;u_^[̋D$QP#S\$ Vt$ ;tWyWPf;u_^[̃D$ QL$QjT$D$RD$PD$A|$̋D$T$V1W+W|$WPF,R_^ S\$ Vt$ +W9D$sr;tJUo|$UT$$RjD$$L$$PL$$QD$4|D$fF;u]_^[̃3ĉD$ QL$D$PQT$RD$4 D$uD$L$ 3̋D$T$V1W+W|$W|$WPF8R_^̃3ĉD$ SUl$ Vt$ +W|$09D$4s];t9SL$QPT$ RD$ D$,uD$G;uʋL$_^][3ZV~t FPD$t VV^VNtAujҋD$@Ft@^̋L$IHtAItAuj̋L$HtA̋L$IHtAItAuj̋L$IHtAItAuj̋L$ HtA̋L$ IHtA ItAuj̋D$9Pr@9QrIPQPQVNtAujD$t V)^SUl$ VW9osGt$+;s\$ ;rÃrPD$ PW u;s _^][3;_^][QD$ Vt$u;Av`QSUW;sP+Ћ;wH+QT$L$r l$ANjvMd$f9tu_][^Y tD$ PUV t++^믃|$rD$_]+[^Y L$_]+[^Y ̃|$ SUVWvYQt$;sNy|$irEōPrEōp;s"|$T$0ϐf91tu;r_^][ |$rM_^+][ _^+][ SUl$ VW9osGt$+;s\$ ;rÃrPD$ P oQd u;s _^][3;_^][̋Au(̃ VFWtPH3|$;vGND?PQFu-T$RL$ D$,hD$ PD$r_^ ̋D$VVLQR"F^̃ VFW|$P;sDNWQFu-T$RL$ D$, hD$ PD$_^ ̃yAu(AAIyj38A ̡̋D$VFt~ t PzD$t V^S\$Vt$Wt*t&VFr;wrNH;v87__^[jhhedPQVW3PD$d|$ jD$Lt!FFF 3VO xNjL$d Y_^̅tj̍A jhedPQV3PD$ dt$LN D$"D$L$ d Y^jhKhdPQ3PD$dj D$D$tL$d Y3L$d Y̋D$T$ Vt$ D$ QR QV^VD$t V^KkVP4҅u@PΣ^̋AHQAWxD$ulS\$UkVd$w;u8O vff;uu3Ʌ f; ɃAt|$?tD$^][_YQAWxD$ulS\$UkVd$w;u8O vff;uu3Ʌ f; ɃAt|$?tD$^][_YjhedPQV3PD$ dt$NDD$(N0D$N D$ND$D$L$ d Y^jh fdP3PD$ dD$jPD$'L$4QL$ hlD$$d$DHtAL$06L$Pj T$,L$Pj!L$0QL$ j T$8L$Rj D$_^S\$VW9^swF|$+;svUNUnr UT$l$rU+PD$P+QReF+ǃ~Frm(]_^[Ujh@fdP SVW3PEde}Ev"_;s+;w4NjQEkE(EeE@jPEME/Ë}u] v rGGSPEVRPr OQMGw_rMd Y_^[]u~r VRTjFFjFOS\$VW9^sF|$+;sviNUnr UT$l$r UT$l$T$+P;B+PQL$$YRF+ǃ~Frm3fLE]_^[Ujh`fdP SVW3PEde}Ev"_;s+;w4NjQE+EeE@jPEE1Ë}u]M v$rGG RPD6PS M rOQM G3҉wOr3fHMd Y_^[]u~r FPj3QFFQfNe;d]D=Pffu+@S\$Vt$WuHÍPffu+ϋ;vÍPffu+hVSP _^[D$VL$POxqPY^QD$SUVWD$Pffu+ˋ+$D$ˍ~ND$p\$rvPQVRjtD$xD$xt(|$,r D$Pt$,D$(D$t(|$Hr L$4Qvt$HD$DD$4t|$dr T$PRLD$xL$hd Y_^[djh@idPSVW3P$d$3ۉ\$9j t$$t<$D$PPL$8Ƅ$D$jPλ3DŽ$tL$4\$lt|$0r L$QJ$d Y_^[Ĥ̋T$VWFFFx@u+PR_^QT$Vt$ 3FFD$fFD$RPQ^Y ̋T$VL$3QFFfFD$ RP^ jhxidPSVW3PD$(djL$=LD$0\$u-jL$=Lu@@@LL$|$85L;p s"H uxtf;p sP43uktcD$WPwuhXL$ hL$ Qt$jL$<5&Fs@FL$89VL$D$0ƋL$(d Y_^[$jhdPHSUVW3PD$\dD$txtLj3hdL$ D$8t$4D$$D$PL$8t$hhLL$8QD$~];D$ut W]L$9KuwtƉCjWC\A ;Cupuw>K SBM9YuAK9uAKHK;tT$8ZE;x8_;ueFxuXVFFxut8YuP8ZtaH8YuZP@8FNH^PV͈ZtxuXVFxuH8Yu8Zu@Ev;xK18YuPZP@0NH^V͈Z_D$PEvHED$lL$tUHL$\d Y_^][T jhidPQVW3PD$dt$ |$ W3jN G RAQPT$$Q5ƋL$d Y_^SVWWL΋P=R {QSjC_^[̋D$VP#@^̋D$VPL^jhidPV3PD$$dj)hL$D$(D$$D$D$PD$0|$ Lr L$ QL$$d Y^(jhidPV3PD$$dj=hL$D$(D$$D$uD$PD$0q|$ 4r L$ QL$$d Y^(jhjdPQVW3PD$dt$ 3FFfFT$ D$txffu+PRƋL$d Y_^jh8jdPQV3PD$ dt$jt03D$F@F@FF@FƋL$ d Y^̃SVFW|$t;t >|$9\$ ufL$$^t;t |$9\$(uFNQRXF@FFF@FD$_^H[$t;|$$t |$\$ ;\$(tL$ SWD$P |$Ƌ6D$_0^X[̃,UW|$8ljl$Pffu+‹T$<;vL$ hD$PVt$DuWpffu+D$DWD$W|$4t;t,S ;[tL$hD$ PBЋtB_^(̋D$VP#4^QUl$VFEu^2]YSWL$QT$RjPFP؅tj|$$t0Pbu Q脻UFjRPEt!EL$QNT$RjPQ@؅uE|$ VfL$(QD$$L$(D$ ?T$0D$,RP辵PƋL$d Y_^][ jhKhdPQ3PD$dj D$D$t(L$ T$QL$RQL$d Y 3L$d Y ̋D$VjjP/^jhjdPV3PD$djjQL$D$D$0jjPL$D$0t$,jjL$QL$ D$D$$ƋL$d Y^ jhjdPV3PD$djjQL$D$VD$0PjL$D$,t$,jjL$Q*L$ D$D$$ƋL$d Y^ QjjD$PD$T$ RPGYUjhjdPSVW3PEdeى]} }ut$;5^ȋB$Єu}EˋV"Md Y_^[] Mjj۲MPEhËEMd Y_^[] M WQ蘲躲PMd Y_^[] jhkdPQSVW3PD$d|$\$$S|jD$ LϽt!WFFF 3VO 2D$,L$(PQSD$(;NjL$d Y_^[ ̃SVt$ f>t.WD${,ID$ PL$Qωt$Kf>u_^[jhjdPV3PD$dL$ D$艽D$4L$0PQT$RD$0 t$,jjD$P7L$ D$D$$ƋL$d Y^ jhjdPV3PD$dL$ D$D$0PL$QD$,t$,jjT$RL$ D$D$$VƋL$d Y^ jhjdPV3PD$dL$ D$YD$0PL$QD$,t$,jjT$R L$ D$D$$ƼƋL$d Y^ jhjdPV3PD$dL$ D$ɻD$0PL$QD$,t$,jjT$R|L$ D$D$$6ƋL$d Y^ jhjdPV3PD$dL$ D$9D$0PL$QD$,`t$,jjT$RL$ D$D$$覻ƋL$d Y^ jhHkdP\3ĉD$XSUVW3PD$pd$$$ |$,3D$t$t$x;-L$,QhXPsD$ = ;tP׍T$RhVhht$(;D$hPL$$%SD$xTPL$D$xSL$hQL$$RD$xSP\L$D$xSguK\u@PhPD$$hT$sL$8DŽ$*s/Ul$\jhsdP3ʼnEXSVWPEdeMlEd]hUpM x}43E0]Uu;;M4QhPM |M|rhl̉eSk>U(jREohE PSE~ M$VEU0M4QhDRw h(h'jj|P"Ek2M0SUR |PEWMEq{U0ShR h(jj|PE6E$EE tHȃ8ujЋE,EE(tHȃ8ujЍETCMd Y_^[MX3k\]]F|zU0PM4QhR'M p|E]zPhPEhPمuMu,'z6hhlĉeXtC萪M,Pj赔M0u,QYPj茕u,MyPj臔M,k2Rjqu,|yPjSMu,xyPj>M,jQM$j莏GE0U4RhP MEoh(jj|QE3}E$EE tHȃ8ujЋE,EE(tHȃ8ujЍEQ3U0M4QhRX 3M6nM܋@q UREЋzxU0PVM4QhhRMEnjhsdP0VW3PD$|RPhVnMELMEM3 tQjjjjtRhVn jtPQ EjhTER<ʅh4PEjjPtEώ4E Rt\QhURWE)_MjE (oEu̍|Ph0MQWE ^MjE n3}؉uEMURpPMEJxEEutHȃ8uj҄MjDP葕jjPMEЍDEQjdQM`jjPME蟍dE`QM[MPTRxEZjPM"TE#QEPX}Et QXXKj<RXLU@twEjP{PMEhIMEIMTZ}PjuM?ZPjuhjthjtMjWjPME2P U荍QhRxk E tGu jҋEĿE }tHȃ8ujҋEE u̅tHȃ8ujҋEE }tHȃ8ujҍtEO<ed ZdEMuEt yuj҉}t~u jҋEȋMd Y_^[3I]MMNM@q UREЋXUPVQhhRhMEENE=[ Ul$xjhxdP3ʼnEtSVWPEde` }f 4 }L3f]]E]]ESPMQEi x};tGEEE ;tHȃ9uj;MQWURhWh EPepu;tFEܻE]؅tHȃ8ujЅu;MQhPWh G]EE u jиCMLQZuRULREPhWYhF]Eu jЃGEE u j3wMLQ[tULREPhH띍MLQh URVIYMjEHi3uEEMPPkEtFu jЋGEt@uTEDžPtHȃ8ujЄjQ轏jjPMEE KMeUPEh( URPbXMjE ahEE`QME jputFd3҅»E `tHȃ8uj҅tVE ]tFu jҋEE EtHȃ8ujҍMEJur}jP蟎jjP@EۆEJjQljjPE訆EiJj`oMXTw@ETd2TQhỦeRdC jjhlhẺePE6C +P0O}hMQWEyV MjExfUjRtuԍ0E8SPjmuԍ@ SPjmMhjmMjjnMh(jmMh(jmEjPjMhuhQ7jjPhE#EHhRtsỦeRBẺePBhQȊPhE(EyHhRPURhPhRPEPhVchpMQWT MjEdUjR9suhEQPjzlu0QPjblEMjPjghxQWT |jE|dUjRrhPME膅jjPE 袃E"cGjjh ςMQ E#蜂h luPPjkuPPj|ku PPjdku0PPjLkU|jRjf E"FEFME?xEP@ME?ME8@hEYFME]?ME@0E2F EcEFE @FME ?ME ?MEEuy]EPhS'a EE@E EE tFu jЋE̾E uȅtHȃ8ujЍMEZEEtGu jЋEEutHȃ8ujЋMEEtAujЃEE tCu jиCUMQhR#` EtFu jҋEEEtHȃ8ujEMuEt yuj҉}t~u jҋEMd Y_^[Mt3>x]XgC @q XRE%ЋMUPVMQhhR ^XECE$CE&UjhydPt3ʼnESVWPEde }f3}E}}EMEBMEBEWPMQ]^ pu;tFE] ];tȃ88u ju"MEBMEBCMQV/URhV ^ EPMQVܞ uUREPV EMQURVP R؃M̅tQSQhx V]MEBBME6B~E}E jjQh V_]EURh VA] MEAMEA~E}]u j3M@M@q UREЋ/KUPVMQhhR[MECEPAE]Ëuȋ]ME.AME"A}t~u jҋËMd Y_^[M3;]UjhHydPP3ʼnESVWPEdeME] M }3E};t9;t5URhP[u kJt8MEPhQ[ CMd Y_^[M3:] hMhuEURhPh[3봋jNtUhMQhHR?[3VuSV uEPh hVYXMQhVZ DM>MRq EPEҋIMPVEPhhQYMECE>?hË}Ul$hjhydP@SVW3PEde3ۉ]d]P]`E\M]#>M8E>EpSPMTQEuZ pu`;tFEX E}T;tHȃ9ujhVhXVYhM(Q肀PM8EM(E9>M8H;uNhhV}Y M8E>ME>E}\;tFu j3M8GPhhV&YM QVu$M8EEpRGPhUHRVRJMLSERZ3uXETEMLE0P\ ]dE tFu SЋwuXt ^}pt2EdEt'E4edE0tHȃ8ujЄtjMQˀPME ~MEAuKjhM;At8WSV htu)hhV3QME6chthV?R ME63Md Y_^[] M6MRq EPEҋF@PEVhthhPPMEm6jhzdP UVW3PD$0dL$5l$LD$8@tD$PPL$謑?PL$hQ3K L$?|$@PT$$Rxt$XPD$<eL$ D$85VD$XL$LT$HPVUjQRW D$8L$t52L$0d Y_^],f5L$0d Y_^],jhzdP UVW3PD$0dL$q4l$LD$8?tD$PPL$蜐>PL$hLQ#J L$>t$@PT$$Rw|$XPD$<UL$ D$84D$TL$HT$DPWUjQRVD$8L$tv42L$0d Y_^],\4L$0d Y_^],jh {dPh3ĉD$dSUVW3PD$|d$$$$$L$4D$ $ |$TL$$T$8D$ 3t$3Ή$=tSL$(9==T$4PhHL$QR8@L$WƄ$3P|$PD$LL$D$UE$D$ L$3uEE M|P@E tFu jЋwutFEE Dž|tHȃ8ujЄjQE _ePME }E c!jR3ePME |E 7!jTPePME|TE !j$QdPME|$E jDRdPMEb|DE j4PdPME6|4E j~EjQ΋LdPME{E P UWREPMQUREPE܍MQMURU PQR",uE'E lQh@q lREЋ)U PVM(QhhR9lE'EE ËuEtFu jҋEEEtHȃ8ujҍMEMMEAME5ME)MEMEMEE'l?d@q lREЋ}(U PVM(QhhR8lEE ÍMEME}MEqMEeMEYMEMME>2Md Y_^[Mh3l]jh4~dP43ĉ$0SUVW3P$Hd$X$`$d$\$hh4D$4W$L$,Pˉ\$DT$8_j3VPL$h$\Y$Ƅ$Pch WL$TQ^jVPL$HƄ$\lYL$LƄ$P+T$RhhhƄ$`t$,t?D$;tPt$L$<Ƅ$PL$\DŽ$P3$$$ f$T$$ QVRƄ$\t$4d o$9$$s$L$,VP't$$Ƅ$P t$9$$s$T$L$QhPR($@$<f$,T$$(QVRƄ$\ t$,詶 D$;tPӋ$,t$9$@s$,T$L$QhPRsJ$$f$3ɉ$$f$3҉$$f$$$f$T$$QhRƄ$\m 9$r$P3ɉ$$f$9$r$R3$$f$9$r$Qn3҉$$f$Ƅ$P 9$r$P53ɉ$$f$D$$Pff;u+‹T$$P$RPV$9$r$Q3҉$$f$9$r$P3ɉ$$f$9$r$Rd3$$f$Ƅ$P 9$r$Q+3҉$$f$L$$PhQp 9$r$R3$$f$9$r$Q3҉$$f$9$r$Pq3ɉ$$f$Ƅ$P 9$r$R83$$f$T$$QhR} t=$,$,$,$Ƅ$P ,L$$PhQ" uD$T$4Rh|P觯 u$9$s$jVPL$XR$Ƅ$P9$s$jVPL$xR$Ƅ$P9$s$jVP$RL$4QT$PRD$tP$QL$@T$LRD$pPQƄ$lL$|Ƅ$PL$lƄ$PL$LƄ$Pu3$9$$s$L$8P`{r$P+$D+$8+$Ƅ$P $+D$ @$(RPD$(D$ P I9$@r$,Q 3҉$@$<f$,D$;tPӋD$Ƅ$Pt$;tPӉt$D$(T$$ @QPRD$4t 9$$r$Pg D$3ɉ$$$ f$;tPӍL$MMVPMEME ME M,E E(E E$tpȃ8ujEtsu jЍMEELEEHtpȃ8ujЋM@Et qujЉutwu jЋEMMRq EPEҋMTPEXVPhhQ4MEE*ÍMHEM3Y3`EE8߅tC;EtEuu"j YtM]SkYFt5^WVu>;uF_^[ÅtvVYYCVY3׋SVW`jStv>VYYuX|_^[h2YËUSVW} t}t?uEt3f3_^[]ËEuxpJ0@E uEtff3@u u>YtTSFY~-39EPujVj u t&SYu&*_u% H%KDt[SwY9Es jXS_Y~(39EPuSGYPWj u i_f39EPujWj u BjDhL$Mu eEPMhEPjDh\$M= eEPMmhLEP\̋Uu]ËUu]ËUu]ËUu]ËU\u]%MH\ x] x@\t t\ r%H̋D$uFx!t^Hy!ux!u Iȋx!tN^Ë@x!uN;HuFЋBx!tF^̋T$BV0r0~!uVrpI^;Qu ABJ;u BAB̋T$Vp2p~!uVrpI^;Qu APBJ;Qu APBPBV>uFx!t@Fx!te^y!u Ax!u$ȋAx!tN^Ë@x!u$N;uFЋBx!tNy!t^JF^̃j$QtHtHt@ @!V t$Ph@*V ^SVW|$!ًu&FP6O W~!t_^[SVW|$!ًu&FP6OW~!t_^[jh8jdPQV3PD$ dt$j9t03D$F@!F@FF@FƋL$ d Y^jhdPHSUVW3PD$\dD$tx!tLj3hdL$ D$8t$4D$$D$PL$8t$hhLL$8QD$~];D$u!t W]L$9Kuw!tƉCjWWC\A ;Cu!puw>K SBM9YuAK9uAKHK ;tT$8Z E;x8_ ;ueFx uX VF YFx!ut8Y uP8Z taH8Y uZ P@ xFN H ^ PV͈Z tx uX VF Gx!uH8Y u8Z u@ Ev;xK18Y uPZ P@ N H ^ V͈Z _ L$ D$PEvHED$lL$tUHL$\d Y_^][T jhdPHSUVW3PD$\dD$tx!tLj3hdL$ D$8t$4D$$D$PL$8t$hhLL$8QD$~];D$u!t W]L$9Kuw!tƉCjWwC\A ;Cu!puw>K SBM9YuAK9uAKHK ;tT$8Z E;x8_ ;ueFx uX VF yFx!ut8Y uP8Z taH8Y uZ P@ FN H ^ PV͈Z .tx uX VF gx!uH8Y u8Z u@ Ev;xK18Y uPZ P@ N H ^ V͈Z _ L$D$P裿EvHED$lL$tUHL$\d Y_^][T ̃SVFW|$t;t |$9\$ ufL$$^t;t |$9\$(uFNQRF@FFF@FD$_^H[$t;|$$t ?|$\$ ;\$(tL$:SWD$P||$Ƌ6D$_0^X[̃SVFW|$t;t |$9\$ ufL$$^t;t |$9\$(uFNQR8F@FFF@FD$_^H[$t;|$$t _|$\$ ;\$(tL$ZSWD$P||$Ƌ6D$_0^X[jhdPLSUVW3PD$`dى\$3L$Pl$ht$|jUVL$LD$tVD$l.L$@EL$(D$(PD$ljUL$0QL$(D$hL$@D$hL$PD$hD$tD$hD$p;tHȃ9(ujЋ3t$D$l$,D$(D$h|$t3L$xPQL$ !$PRh*D$4PWD$htFu jЋwt$tFD$$D$hD$ tHȃ8ujjL$8QD$htEu UjЋol$,tED$u/+ЍIf fuƍPffu+.f9LFuf9LFuD$ h/PV ^f>\u!f~\uNj\QVtj\Pj\Vbu3f^3fH^ËT$/ǀ tVWx+2f4fu_^/ tQV>t&#Ft Pҋtj^Q̋ ̋D$ /̋APGYD$V/t VN^̋D$yud$yt̋L$u,xr@L$fT$ fH L$fT$ fH xr@T$WdPQ3PD$dL$/D$QL$d Yjh>dPQ3PD$dL$/D$QL$d Yjh>dPQ3PD$dL$0D$QL$d Yjh>dPQ3PD$dL$0D$QL$d YËtPVD$t V^VD$t V^VD$t Vߙ^V8D$t V这^V>u!Fxt^Hyuxu IȋxtN^Ë@xuN;HuFЋBxtF^̋P<Y̋D$VW~u4Ff8tUOF;sM@ΉFۏNfuqFxt@Fxte^Vyu Axu$ȋAxtN^Ë@xu$N;uFЋBxtNyt^F^jhȍdPQVW3PD$d uMW|$D$ uNjFPQ D$tW3 L$d Y_^jhȍdPQVW3PD$d tuYW|$D$ tuNjFPQU D$tW L$d Y_^jhhdPQ3PD$dD$L$/HD$T$(0 HD$L$d Y̋AIPQ蓃jhdPQV3PD$ dt$D$ L$PQ7D$T$$40F D$ƋL$ d Y^ jhdPQV3PD$ dt$D$ L$PQD$T$$0F D$ƋL$ d Y^ jhdPQV3PD$ dt$0D$(0D$D$/t VrƋL$ d Y^̋A QPARP jhȍdPQVW3PD$dW|$D$D$ tV+I @uD$tWL$d Y_^fyWytNXtXPWX_j\WwtfxtfGfu_UE4S]ÍPffu+Vvf;\uf} \u f} \u ufWf\u~f?\uVWqf>\t;uf>\u'f~\t SE Pf>\uf~\Fu PV:f>.F\f;uVNQff.u]f9NuWF;tAs;r3f9t;tr3f9u;tf>.uf~.u f9NuVPf_^[]S\$Vt$ WuSh2j" ƍPffu+=vG uVSh1j~Guf>\uf~\tVSh0j~_^[ ̃ H$t&H$PBhjHЅu$$ujL$Qhu ËD$ ̋T$IHf9t u؃unV2pJtpPVp^f r)=//1t( \w'P$<^3^ø^ø^ø^ø!(/V1W~F諆f8t!Od$F;s@ΉF莆NfVD$5tgt;~EȀ utY-f`f>:uM ;uD$LE u?t _f.SWhp7Et _fSWh7jkGf>T|$t.Eu!t -fShp6jk tFf} :u? QuSh6jpk E f\tftSh5jQk _^][ỸUl$VNAxWuMI9H s@xtS^|$D$t;t;[tE;G rL$ NL$T$L$D$ I_^H]S\$VWtD$9F w;Fv 踃D$|$  C9~ w;~v 蚃|$ t;t腃S;t'F+ U,~ QWQRzn]_^[VFuF$<u^^̃SUVWjҡhPωl$\$҅uH%BЍL$Q T$$RD$Ppt$L$t;t褂;L$el$,t$t;t}\$;\$tgu/j3;Xu^C UP|uL$\$벋ԅu(3;^u)C RP_^][6_^]2[S\$V+F;w軎W~v蠎F;s;NQW請v`D$NPSQ~~r=F3fx_^[uω~rF3_f^[F3_f^[F3fx_^[SUl$ VW|$9}s2E\$+;s؋F+;v;sӍ~v蹍F;sFPWĊ}r3m1u~rF3_f^][ F3_f^][ FrVVNS\$+\]SPJR-w~~rF3f x_^][ F3f x_^][ jhxdPVW3PD$ dD$h2h2L$$FLD$3fND$|$t$t BЋjD$ƋL$ d Y_^ jhdPVW3PD$ d|$ h2h2L$(~D$h8W|$$WWLD$|$ t$t PҋjD$ ƋL$ d Y_^ jhdPQSVW3PD$dh8h2L$D$|$(\$$h8WSSAhWD$t$t$t PҋjD$L$d Y_^[jhؑdPQSV3PD$dh 9h2L$D$ND$$T$ #;t# ‹ΉF=D$t$ t$Ht PҋjD$ L$d Y^[jhdPSUVW3PD$dًl$$UsVh0;L$03|$CuD$(th:jcCuh(:jcEf;u9D$t$$;~vt BЋjЉ|$$Y.f9>uf9{ u \f9s t*\f;uf9}uf9uuB<˃f9}tCPffu+ōPIffu+tu%D$(tf|u\thVWhx9jb >r:S tD$(t ++hVWhx9jhbFVCUP D$( tD$(D$(hPD$t$$t$t BЋjD$$L$d Y_^][ jh8dPQV3PD$ dh0<h2L$9D$FtFPh;ja NhQ:hjD$t$t$Tt BЋjD$L$ d Y^jhvdP$3ĉ$ SUVW3P$8d$LP0$HҍShd$ffu+UGPR+ uGR(%PLoQSL$DŽ$@L$f|$uDŽ$@D$wF%P$(1Ƅ$@@@$$QT$RЋB(jh/ЋR$$PƄ$@$$DŽ$@D$$8d Y_^][$ 3'u0jhdPV3PD$dt$D$ Qd$d$P,D$TF@F@FF@FD$ƋL$d Y^SVL$ WtI~Fr;r4rЋ^Z;vrT$+RQV_^[FUl$+;v(;s蟄~v腄F;sFPW萁vlF^r20u~rF]3_f^[F]3_f^[ӋNUl$+UPJRn~~r3f{]_^[jhdPHSUVW3PD$\dD$txtDj3hdL$ D$8t$4D$$zt$dD$PL$8XhLL$8QFw؍L$p\$j yt{SztD$txP;uksuwE9Xux 9u>~];D$ut Ws]L$9KuwtƉCjWC\A ;Cupuw>K SBM9YuAK9uAKHK;tT$8ZE;x8_;ueFxuXVF9Fxut8YuP8ZtaH8YuZP@XFNH^PV͈ZtxuXVF'xuH8Yu8Zu@Ev;xK18YuPZP@NH^V͈Z_D$PnEvHED$lL$tUHL$\d Y_^][T jhؑdPQVW3PD$dh<h2L$D$|$ ;u.D$|$ tst PҋjMGPOhQD$|$ t$t BЋjD$ ƋL$d Y_^jhؑdPQVW3PD$dh<h2L$D$D$ HQPD$t$ t$t BЋjD$ NjL$d Y_^jhdPQSVW3PD$dhP=h2L$D$|$(\$$h4=WSWS D$t$t$t PҋjD$L$d Y_^[jhؘdPDSUVW3PD$Xd?rDj3hL$D$4t$0D$ kt$`D$PL$4)hL$4Q7rT$tGt$pjRPVPG_;uhG(Oi"|$lt .G;0u(nG;puhUzEQ; uQRzuYZJAr;qu VFXNQBFHQ{zuYZJAr];1u VFXNQBF@HPzuBPQW;BuJP;u JHNyFWBXD$hhL$Xd Y_^][PSVFW|$t;t o|$9\$ ufL$$^t;t o|$9\$(uFNQRF@FFF@FD$_^H[$t;|$$t o|$\$ ;\$(tL$:SWD$P<|$Ƌ6D$_0^X[jhQdPQ3PD$dL$L$L$D$tD$jjPٜD$L$d YVt$WxIffu+PVz_^̃ S\$UVWwFxL$u;P L$t@xtl$T$tQG(t;tNnL$;u*SVjQ,_ȋD$I^]H@[ l$T$E ;s1L$SVQT$ R_ȋD$I^]H@[ D$ _^h]@[ ̃S\$ VN W~+;v.;vmV+V L$,Q+SWP9_^[sP;vhmUn D$;nvTmST$$L$RL$l$L$PWQRPL$(QD]_^[̋D$ Vt;D$t lD$L$;L$ tmu lD$t3T$;PrlD$PL$QD$u lD$t3ɋT$;Qr lD$D$v^ ̋D$VW|$ >FO;w jPu +jP,r ~_^GF_^jhhdP V3PD$dt$D$FPQRQD$PFP2eFFD$ QeL$d Y^SUVWIF;w jUt+jQ?~^rËT$L$RQUPk}$FFv r3fu W:_^][QD$ SUVWD$F;w jS t+jQ~nrEōT$RSPD$$jjPhu=xN~vrm3fMzuT$뀉T${_^][YW_^][YjhxdPl3ĉD$hSUVW3P$d$L$t$W&3퉬$FHQF@FnF@D$jPL$$,T$,+T$(weit$(L$QUVPBЅtND$jPL$$lD$,L$(;v iD$,L$(t$;viL$SVWQL$$D$;TsU=jT$8RP;vXD$89D$4u-|$Du#jL$`QPD$ ;vT$RD$TPL$@T$4jL$8QP;wDŽ$L$\$d Y_^][L$h3dx̋L$D$ PQL$ ̋L$D$ PQL$ jhdPV3PD$dt$ D$ PL$QD$ƋL$d Y^jhۓdPQ3PD$d=u;j gD$D$t U3D$P3L$d YjhdPSVW3PD$d|$ >3ۉ\$ 5;tt$\$ V=` D$ L$d Y_^[̋D$L$ T$PD$QjRP̃L$D$PD$QL$T$RjPQD$D$=tu <$t SUVWUqL$~ WP^SFD$$jPQ/=u=/t tuVUR*gL$WPSFD$$jPQ>uNt tu8Ntf|At%B;vUQfF3fTY>tFUjP _^][̋APfỸy(uÃSUVt$ WD$D$~FD$Ar jjAnA+jQ~rFFl$ L$T$RPD$PjUQ~΋FTf8tOF;s@ΉFTVfG|Ћ@P_^̋D$ 3VW|$ t;t^F3;G_^jhhdPQV3PD$ dt$j衶D$ >D$ƋL$ d Y^̋T$L$L$ HL$PP IT$HP@VW|$u|$t$ PD҄u PL҄t%PHjҋB$h\@i |$t hT@UD$WP+v6T$pffu+DBf tf t hP@ 褨 P?_^VW|$ t;t]F3;G_^̋L$ w3Q] 3sjL$EhD$PG]V>u\Fxt^\Hyuxu IȋxtN^Ë@xuN;HuFЋBxtF^V҅u^ËW҃xrxҋ_^Íxҋ_^V҅u^ËW҃xrxҋ_^Íxҋ_^UjhdP SVW3PEdej[EEtUHtEHtEP@Md Y_^[]ËEPyTjj[UjhdP SVW3PEdejZuEuEtEPMQURE PMQIEEƋMd Y_^[]URSjjZjhdPQV3PD$ dt$D$ L$PQWD$T$$l@F D$ƋL$ d Y^ jhdPQV3PD$ dt$l@D$(0D$D$/t VSƋL$ d Y^jhdP@3ĉ$<SV3P$Ld$8DŽ$Tht@$<}5ht@$<PL$Ƅ$TT$BL$ QL$ЋD$uxht@$<Ƅ$TD$/Ƅ$T$ QքuDŽ$T$8S3$Ld Y^[$<3TLËƄ$TL$(DŽ$T$8jh@dPQVW3PD$dt$ 3|$F ;t PHQ~ ~~D$P,QL$d Y_^jhpdPQ3PD$dL$D$PPL$d YjhۏdPQV3PD$ djMWD$D$tL$$QL$ T$$RQ3D$ƋL$ d Y^ jhdPQ3PD$dL$D$PPL$d YjhؗdPV3PD$dt$Qd$d$D$ƋL$d Y^jhؗdPV3PD$dt$D$ Qd$d$QND$ƋL$d Y^jhdPV3PD$dt$Qd$d$3D$FFFFD$ƋL$d Y^̃Ul$VNAxWuMI9H }@xtS^|$D$t;tT;[tE;G |L$ NL$T$L$D$ I_^H]jhPdPQ3PD$dL$D$PML$d YS\$Ul$VW|$9~r9]sIaE+Ë\$ ;s؃+F;w`;nl$v`F;s#NQU] FNr20unrF3_f^][F3_f^][уr n++U+ÍzRP AQJD$(;uGD$;sÉD$FnrUՃrMS\$ +ǍZRPyPzJ9xrPPFnrMS\$ +ǍZRPyPID$$~Frm3fLE_^][QS\$UVt$W|$$9ur9{s_MT$+;sЉT$C+Nj|$(;s++;wL_ET$؋+++ʉL$\$;sCv _T$E;sMQS'\T$u]rEE3f];l$ Er ˃rT$(\$(T$RT$ +֍ Q+QPD$4> PQ IT$0zr‹PEr W|$(+ƍzRPqPPHu;Er ˃rT$ \$ ?RT$( QT$$+QPrPHEr ˃rT$$\$$T$RT$ +֍ QT$(+QPrP:HL$$;Er ˃rT$ \$ T$RT$ +֍ Q+QPD$,> PQGErӃr W|$(+ƍzRPqPGUD$ ;Ewr ˃rT$(\$(T$RT$$ Q+Q+PD$4> PQuRErT$ \$ rӋL$$+L$Wϋ|$$ OQ+PrRr ˃rT$(\$(T$RT$( QT$,Q+PrPQEr ˃rT$(\$(T$RT$$ Q+Q+PD$4> PQQErT$\$r ˋ+T$+RT$(׋|$+D$ WRPD$, AQlQD$ }Er_3fC^][YjhdPV3PD$dt$D$ Qd$d$PD$ƋL$d Y^SVL$WtS~Fr;r>rЋ^Z;v)rT$+ȋD$RQL$VPQV_^[|$9~s[FUl$+;s\$ ++;wZN++͉L$ ;sMFrVVT$rVVQL$T$+Ǎ/QL$+RPARDwF+ÉD$=v ?ZD$N;s/NQPFWD$;suFNr6T$2u߉FrF]3_f^[F]3_f^[L$r T$ R+Ǎ/l$+ÍTURP AQDFnrM͍RT$ +RPyPrCD$$~Frm3fLE]_^[jhxdPV3PD$dt$D$ Qd$d$PcD$ƋL$d Y^Vt$WxIffuT$ +PD$VPRp_^ SV3W9^t3F;t#NDN;w+V .b~u^9^uы~;vFO9t Q E;wF;t PD_^^^[jhdPV3PD$dt$D$ Qd$d$PD$F@F@FF@FD$ƋL$d Y^jhdPD3PD$Hdjh<L$ D$$D$ D$8mD$PD$PL$$thL$$QKjhؘdPDSUVW3PD$XdrDj3hL$D$4t$0D$ lt$`D$PL$4ythL$4QJT$tGt$pjRPVPG_;uhG(Oi"|$lt .G;0u(nG;puhUzEQ; uQRzuYZJAr;qu VFXNQBFHQ'<{zuYZJAr];1u V;FXNQBF@HPzuBPQW;BuJP;u JHNyFWBXD$hhL$Xd Y_^][PjhdPHSUVW3PD$\dD$txtDj3hdL$ D$8t$4D$$jt$dD$PL$8rhLL$8QH؍L$p\$J yt{SztD$txP;uksuwE9Xux 9u>~];D$ut W]L$9KuwtƉCjWoC\A ;Cupuw>K SBM9YuAK9uAKHK;tT$8ZE;x8_;ueFxuXVFFxut8YuP8ZtaH8YuZP@9FNH^PV͈Z>txuXVFW9xuH8Yu8Zu@Ev;xK18YuPZP@NH^V͈Z8_D$Po?EvHED$lL$tUHL$\d Y_^][T jhdPQV3PD$ dt$D$D$P>L$ d Y^̃ S\$UVWwFxL$u;P L$t@xtl$T$tQG(t;tDL$;u*SVjQ|_ȋD$I^]H@[  l$T$E ;}1L$SVQT$ R7_ȋD$I^]H@[ D$ _^h]@[ ̃SVFW|$t;t >D|$9\$ ufL$$^t;t D|$9\$(uFNQRF@FFF@FD$_^H[$t;|$$t C|$\$ ;\$(tL$ SWD$P,|$Ƌ6D$_0^X[jhؗdPV3PD$dt$Qd$d$踼3D$F FFD$ƋL$d Y^̃V~Wu!D$,N|$ PQjW_^L$$V:t;t BL$$D$(;u)|$,;H HW|$$PjW?_^~t;t BD$(L$$;Nj|$,u+VBH ;W|$$PjW_^9P ~aL$L$D$ D$ 9P }:PzW|$$tPjW_^D$,PjW_^D$(L$$9P }wL$NL$L$D$ T$ D$PL$ L$ u;Q }F~;v6(6jL$t$|$T$ L$LD$T$T$HQRL$D$ L$8d Y_^8VD$t VO!^jhЛdP$3ĉD$ V3PD$,dD$@t$E39=}EP#EMQ#EURh#EEPM#EMQ2#EUR#EEP#EMQ#EUR#EEP#EMQ#EURu#EEPZ#EMQ?#EUR$#EEP #u΋Ћ؉]]SE΋BlЅʤ|9}u EEP΋RpҍMG?E}E MUREPMQ)BtUR@MQR EPh#W M>E9}̋EsEMQPUR hAj}t4X΋h(#?9}EsEPh)# $h(# 9}EsEPjEM3EM 3E+BE Ph-#M E Ëu]9}tM Qh-# EtSMd Y_^[M3V]Ujh@dPQSVW3PEde]6EjjSjEq ËMd Y_^[]Ujh`dPSVW3PEdeu΋Pl҅t"Md Y_^[]EE3Md Y_^[]ËMEE/ ËEMd Y_^[]U$,jhdP3ʼn(SVWPEde3;~ MMQQj EPQh(#mPM;EhMQ;PURhBEPұ 9uEsEjhAPj 9uEsEPg/e Pd8EM,0Eq 2Md Y_^[(3,]VFu+Fuc~u j~F^jhȍdPQVW3PD$dҋVt$D$L$$D$(PQT$ RD$tVL$d Y_^jhȍdPQVW3PD$dҋVt$D$L$ D$$PQcD$tVL$d Y_^jhdPV3PD$d5T$ L$ QRhBL$D$D$jXft Pj{ joD$t$t$Wt PҋjD$L$d Y^QPl҅t Ch8D$PYV^̹jhdPD3ĉD$@UVW3PD$Tdl$lD$ht$dD$ul$|$pt&Єu$jjh(VjjЋB\ЃuL$pT$QURVMP ҅L$7D$\D$UPL$ 蔪}AjjhCVL$ jUQVBl ЅuBpjЋo~4o;l$,v|$0D$sD$fWuuuju օ5HSSWuu u֋ȉM;E t)9];MuuWuu u;~Ej3Xr9D =w,;tjPY;t 3;tAuVWuu uHt"SS9]uSSuuuVSu EV,Yu#EYY]]9]u@E9] u@E uYEu3!;E SSMQuPu <E;tԋ5DSSuPu u։E;u3~=w8=w;tPY;t 3;tuSWM& uWuuu u։E;u3%uEuPWu u苔u#uWYuuuuu uD9]t uYE;t 9EtPYƍe_^[M3;ËUuMSu(Mu$u uuuuu ( }tMap^ȋAl;tQpu ËUu ME~EPju= MH}tMapËU=uE A]juYY]ËUu MfE~EPhu軔 MH%}tMapËU=uE A%]ju~YY]ËUu ME~EPju8 MH}tMapËU=uE A]juYY]ËUL3ʼnES3VuW]ԉ]]]؉]܉u]9^F9u PF0hPESPajjWEjWEjWEjhE$E9]|9]s;k9]b9]YEԉ3M܈@=|EPvL/}%EE~-8]t(E:tx M G;~@@8XuۋESSvPhu܉EjS MESvWQW@PhvS$ESvWPEW@PhvSS$`E}3҃}fU؉Mč_ZMMȈ~S8]tNMM:tBI;ʉM'HMEfAAM̋M 9M~MAAM8YuhQPjPWEjQP$;tKPu@-P9+P&+P EEEĉEEȉEЉuYmuuuu3ۃCˍ;tPdžKdžOdžQdž3M_^3[XȋAl;tQpuËUEu]]~XȋAl;tQpu:@XXȋAl;tQpu ËUVW3uYu'9vV;vuʋ_^]ËUVW3ju u u'9vV;vuË_^]ËUVW3u uYYu,9E t'9vV;vu_^]ËUVW3uu u菒 u,9Et'9vV;vu_^]ËUE3;tA-rHwj X]Ë]DjY;#]FVu@Ã3VuDà ËUVMQY0^]ËUQSVW5T5} TYY;+ߍCrwW_CY;sH;s;rPuoYYuG;r@PuYYYt1P4&SYuSV SYEY3_^[ËVjj VR ujX^Ã&3^j hHj|euYEE Edj|ËUuYH]̋L$t$tNu$$~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+ËU(3ʼnEPVtj XY裐tj襐YPffffffuEDž0@jPjP6 (0jDž@,(Pj|̋UM PU#U # ʉ P]Pd5D$ +d$ SVW(衼3PuEEdPd5D$ +d$ SVW(衼3PeuEEdËMd Y__^[]QËUSVu3W;to=@th;t^9uZ;t9uP9ĘYY;t9uP蔖YYYY;tD9u@-P+P+P=t9uP7YY~PEt;t 9uP\Y9_tG;t 9uPEYMuV6Y_^[]ËUSV5W}W֋tP֋tP֋tP֋tP֍_PE{t tPփ{t CtPփMu֋P_^[]ËUW}SV5W֋tP֋tP֋tP֋tP֍_PE{t tPփ{t CtPփMu֋P^[_]ËVtt;tWj6Y PY_^Åt7t3V0;t(W8YtV>Yu tV3Y^3j h dPFpt"~ltOpluj vYdj YYeFl=iEEj XYuáH H   8 p tjh@duj YYeFtPuF=tPYE[>tCuW~uQhH$udN% 3t VVVVV;t 3ffGfG`;t0dGV)YP;s,Vh%YYVX%YYLlVPYYlPSP藚 CTlPWh >t P;r LJ$@PVWXѓt3VVVVV39\tjS\+ 9`tjT` hud# t VVVVVuh3M_^3[ËU3ʼnESWHuhPPPhxPSu3E0sHxP*$YYxxPTPtJYYptCHM\D klX1jPdjhhW3ۉ]}v#SSSSSC3,BuNp]jhYY};j _LYENl]uM [YE;9] thu YYt j LYE^lWYFpu2u);j Ph 7e-}܋u3j JYËuj JYWWYYE EVËufpËUuM}}3uuuu P}tMapËUuMLE~MJf9t AAu+Hu uPuuu H}tMapËUQSV3;u%j^SSSSS0FW9]wj^SSSSS0"39]A9Mw j"ЋM "w]9]t-NE؋3u vW0AE3;vU9UrڋE;Er럈IIG;r3_^[ U} Eu }jj juuM ]ËU S3V;uj^0SSSSS?9]v39]@9Ew j"ˋE"wUE ]9]t-wE؉u] u uPR~]ڋЋÃ vW0MFAMwv;MrƋM;Mrij"Y3BNEN@E;r3^[UW}juuu u_]ËUEf@@fufM HH;tf9uf9t3]ËU} t j-ZfV3u vW0fAAw3fIIffIfIFF;r^]U} Eu }jj juM E ]ËUSu M,]sTM胹~EPjS{uM Xt}tE`pE胸~1]}EPE%PYYtEjE]EY*3Ɉ]EAEjpUjRQMQhpEP$kEt M }tMap[ËU=uEHw]juYY]ËU S39]u SSSSS;E Vu;t!;uSSSSS tEBuu=?v EEWuEuuP{;t5Mx EE EPSMYYMxE EPS5YY_^[ËUujuu u]ËUEfU f;t@@fuf9t3]ËUSVuW3;uWWWWW  BF t7VVݧV襧PҦ}F;t PY~~ _^[]j hPM3u3;;u}WWWWW F @t ~ E!PVY}V*YEEՋuV0YËU WV覨3Y;u WWWWW+:9} tEIuu=?v EEuEuu PU_ËUVuEPju h; t^]ø%1l%M<ËU}t]̍B[Í$d$3D$ST$t :tτtQu WV ؋ ~333ƃu%t%uu^_[3ËB:t6t:t't:tt:tt^_B[ÍB^_[ÍB^_[ÍB^_[ËUMVW}t1U fGGBBftIutIt3Ћ f_^]̋T$ L$ti3D$ur=tSWr1كt +шuʃtt uD$_ËD$UWVu M};v;r=tWV;^_u^_]\ur*$dǺr $c$d$Xdcd8d#ъFGFGr$dI#ъFGr$d#ъr$dIdddddddxdDDDDDDDDDDDDDD$dddddE^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $`f$fIǺr +$de$`fteeeF#шGr$`fIF#шGFGr$`fF#шGFGFGV$`fIff$f,f4fE uuYY_^[ËU 3ʼnEES3V;u'SSSSS谼WP`Ph~-_jSYYtlDžt^VS3;tPf\tf/uf;Ft1j=XfEPYj:fEXfE3fEVEP\t 3xPY_9tVYM^3[:ËU3ʼnESVu3W} ;t3VgYu/y[ SSSSS{l;tE; ,ωE3f];tj:XfEj.X@fE3fufE j.XfE3fE5XEPWuEP;th;t;E}j"3fV;E~EjuƼYY;u $EPWuEP;t;E|xPY3M_^3[j hCj8Yeu uj EE ECj7YËUu M轶EMA%}tMapËUjuYY]ËUhu_YY]ËUjuLYY]ËUju9YY]ËUUf BBfuJJ}Vtu Mf BBFFft }u3f ^]ËUSV33W9u];u"VVVVV7} ;tuM趵E9pu?fAr fZw fAr fZw CCGGMtBft=f;t6EPP0EPP0CCGGMt ftf;t+}tMap_^[ËUV3W95u39u};u)VVVVVI`U ;tfAr fZw fAr fZw GGBBMt f;tf;t+Vuu uw_^]QL$+#ȋ%;r Y$-̃= \$D$%=u<$f$ffd$uUɽ= t2\$D$%=u<$f$ffd$uu $b ÍT$ R<$tLD$ f<$t-Hnt^uA=, `)uԩu|$u%t-0"xuŃ|$u-= `ZËUSVuF Ȁ3ۀu@t9FW>+~,WPVʖYP ;uF yF N _Ff^[]ËUVuu V5Y/V|YtF @tVaP_YY3^]jh>3}}j3Y}3u;598t^@ tVPVYY3BUH t/9UuPJYtE9}utP/Yu E܉}F3u4V YYE}EtEu>jT2Yj h>39uu V Y'uYuuYEE E#>uUYjYøháVj^u;}ƣjPYYujV5YYujX^3ҹh  |j^3ҹxW t;tu1 B|_3^;=d t35讴YËUVuh;r"w+Q1N Y V^]ËUE}P1E H Y]ËE P]ËUEh;r=w` +P0Y]à P]ËUME }` QP0Y]à P]jh( <: u339} ;uaWWWWW聲;VY}Vuuu VUEVWE E;ËuVYËUu juhyY]j hH];339u;uVVVVV_cj [PjnYYuLPYE PVu4PJE$PWSE E; PjyYYËUVu| J;0|A0@^]ËUSVI%3;u@STW9^(ujWYYF(;u@S0v(huYPWVSt SSSSS詯_^[]ËUMS3VW;t} ;wzj^0SSSSS蛰0u;uڋъBF:tOu;u?j"Y3_^[]j hh9j.YeuNt/@<Et9u,HJP-Yv$YfE 9Ëju-Y̋T$L$u<:u. t&:au% t:Au t:au uҋ3Ðt:u ttf:u t:au t눋UQVu VE F Yu N /@t "S3ۨt^NF F F ^] u,p ;t d@;u u YuV1YF WF>HN+I;N~WPu Z EM F yM tt 0@ tjSSQ#ƒt%FM3GWEPu E9}t N E%_[^ËU@ @txtPuYYf;u]]ËUVuEM >Yt} ^]ËUG @SVt7u1E0MP~CC>Yu=8*uj?cY}^[]ËUt3ʼnEES]Vu Wu3苩9u3WWWWWЬt `p ;t3ɉf; j_i BfXwc3djY; $ 3 ƒ tJt6t%+t   y j _ f*u,[? - k ʍDЉ  f*u&[k ʍDЉƒItWhtFltwf>luxl `f6uf~4u8f3uf~2ufd fifofufxfXRDžƒd/St~At+tY+t+ Dž@Dž0 0u u [u  QPYYtFF9|X+++3F tBPƅPP}fFt:Ht3t+DžPYpegitqnt(oDžtaU30 t ffDž@Dž SufgucDžW9~~=]WYt DžCPPVP5YЋt!uPV5WYYYfguuPV51YYY>-uFVDž$sg+Dž'Džjj0XfQfEE t@tCC@Ct3҉@t|s؃ځڋu3ۃ} Dž9~ u! t-RPSW09~N뽍+FtYt΀90tN0@6u Dž Of8t@@u+e@t+tj-tj+tj XfDž++ uSj YtuWSj0Q uu~qPWP~)YVY| tSj t^Yft*3PPPPP2t `pM_^3[RÍI|zzD{{{{|Ut3ʼnES]Vu3Wu} u53PPPPP:t `p 3;uVVVVVf;t jZ9H AfXwx3k 0xj^;3 $3  tHt4+t$+t { o ` U f*u+6 $ k ɍDЉ f*u%k ɍDЉItQht@ltwf?luvj ^f6uf4u<f3uf2ufdfi fofufxfXQDžTYd0St~At+tY+t+ Dž@Dž0 0u u [u QPYYtFF9|X++3F tBPƅPPZ}fBt:Ht3t+DžPlYpegitmnt$otaU3XV t ffDž@Dž ދCSufgucDžW9~~=]WjYt DžCPPVP5 YЋt!uPV5 YYYfguuPV5 YYY>-uFVDž$sj+Dž'Džjj0XfQfEE t@tCC@Ct3҉@t|s؃ځڋu3ۃ} Dž9~ u! t-RPSWkw09~N뽍+FtYt΀90tN0@6u Dž Of8t…u+e@t+tj-tj+tj XfDž++ uSj YtuWSj0 uu~qPWP~)YV>Y| tSj t跗Y3f;t9t Pt `pM_^3[豒Ë|tMYU(P LHD5@=<fhf \f8f4f%0f-,`ETEXEdXTH L j YjhS=uj Yh P-t"t t Ht3øøøøËVWh3FWP3ȋ~~~  ~ F+ο@Ou@Nu_^ËU3ʼnESWPvL3@;rƅ t.;w+@P j R CCujv vPWPjjdB3SvWPWPWv SDSvWPWPhv Sթ$3EtLtL Ƅ@;rVDž3)ЍZ w Lр wL р A;r‹M_3[cj h<sGptltwhuj .YTj Yewhu;5t6tVutV萓YGh5uVE뎋uj YËUS3SM֎lulh8]tEMapED;FG;v}FF>uыuE}urlj{CgjC C$Zf1Af0A@@JuL@;vFF~4C@IuCC Ss3ȋ {95lXM_^3[^jh7Mj}_huuE;CWh Y؅Fwh#SuYYEuvhuFh=tPlY^hS=Fpj YeC|CC 3E}fLCf Ep@3E=} L@3E=}@5u=tP賏YSE0j  Y%u tS}Y6eEÃ=ujVY3ËUV5 5pօt!tP5 Ѕt'SVu V)YthSP|tuЉEE^]jYËUV5 5pօt!tP5 Ѕt'SVu V(YthSP|tuЉEE^]tV5 pu5eYV5 x^átP5;YЃ  tP|  j hSVuV'YEuF\@Z3G~t$hSP|ӉhSuӉ~pƆCƆKCFhj YevhE>j Y}E FluFlvlYE3Guj t Yj k YËVWx5ЋuNhj\YYt:V55YЅtjVYY<N V茌Y3W_^ËVuj&Y^jhuF$tP?YF,tP1YF4tP#YFt~t WW迃&Y|ܾ_t ~uPӃ|^[ËUE4]j h 3G}39ujhYYu49tnjuY;uܟ 3Qj YY]9u,hWKYYuWY覟 ] >W҂YE EI j (YËUEV4>uP"YujY6^]ËU kU+P r ;r3]ËUMAVu W+y iDMIMS1UVUU] utJ?vj?ZK;KuB sL!\D u#M!JL! uM!Y] S[MMZU ZRSMJ?vj?Z]]+u]j?u K^;vMJM;v;t^M q;qu; s!tDLu!M!1K!LuM!qM qINM qINu ]}u;M ыYN^qNqN;Nu`LML s%}uʻM DD )}uJM YJꍄ ED0E0  5h@H SQ֋ 0  P0 @ 0 @HC0 HyCu `0 xueSjp ֡0 pj5( 0 k+ȍLQHQPƺE ;0 vmE0 =[_^áV5W3;u4kP5W5,;u3x5k5hAj50F;tjh hWF ;uvW5(뛃N>~F_^ËUQQMASVqW3C}i0Dj?EZ@@Jujhy hWupU;wC+ GAH@PǀIuˋUEO HAJ HAdD3GFCENCu x!P_^[ËU MASVuW} +Q iDMOI;|9M]UE;;MIM?vj?YM_;_uC sML!\D u&M!ML! uM!YO_YOyM+M}}M OL1?vj?_]][Y]YKYKY;YuWLML s}uϻM DD }uOM YO U MD2LU FBD2<38/] )uNK\3uN] K?vj?^EuN?vj?^O;OuB st!\Du#M!NL! uM!Y] OwqwOquuuN?vj?^M yK{YKYK;KuWLML s}uοM 9DD }uNM yN ED3@_^[ËUMkMSI VW} M 3U S;#U# u ];r;uS;#U# u ];r;u[ {u ];r;u1 {u ];r;u؉]u3 S:YKC8tCUt|D#M# u)eHD9#U# uEUiDMLD3#u#Mj _G}MT +MN?M~j?^;J;Ju\ }&M|8Ӊ]#\D\Du3M]! ,OM|8!]u ]M!K]}JzyJzyM yJzQJQJ;Ju^LM L}#} u ;οM |D)} u N {MN 7Mt LMuэN L2uy>u;0 uM; u%0 MB_^[hd5D$l$l$+SVW1E3PeuEEEEdËMd Y__^[]Q̋US] Vs35WEE{t N3 8rN F3 8prE@fMUS[ EMt_I[LDEEtWE|@GE؃u΀}t$t N3 8qN V3 :qE_^[]EɋM9csmu)=Yt hY裚tUjRYM [WE 9X thWӋ^WE MH t N3 8jqN V3 :ZqEHV9S RhW WUVEPlY^]Y=mUVY*mEtV nY^]UVW}GtGP:t?u N;tQRWYYt3$ttEtttt3@_^]ËUE=MOCt=csmu+ q~ c3]jh8}]ssu,e;ute~;w| Oȋ1uEytshSOt eu-YËee}]uuE;uti sË]u~ Ë8csmu8xu2H t!t"uxuA3A 3jh`Mt*9csmu"At@tePqvE38E ËeZ ̋UM Vuƃy|QI42 ^]39ËU u X  e?E~SSVE@@ p~3EEMqPGEPL u KEEE;|^[EjKԒt e Mq Mjjrj,hً} u]eGEvEPZxYYEEEMe3@EEuuSuWxEeoEËe< u} ~OO^eE;F skËP;~@;H;FLQVjWeeuEEEE맋} uE܉GuwYMԉMЉ>csmuB~uWt?79t+>MOCt#u$u uuuu V'r} uuEPEPVu WosE;Es[S;7|G;wBG OHtyu*X@u"u$u u juuuuuEE;Er[_^ËU,M S]C=VWEIIM|;|]ucsm9>~ F;t=!t ="~N<u.jVE螑YYu9>u&~u F;t=!t="u ~ut|u3YuO39~GLhdu F;7| juQYYhZM$h<EPkucsm9>~~F;t=!t ="e} EPEPuu WGqE;EE9;G|GEG E~lF@ XE~#vPuE uM9EME}(u$]u EuuuuVu KuE]}}t jV'YY}%=!VY}$MVuu u$mujVuu v]{ v&})u$u uSuuu V tT_^[ËUVu0aY^]USVW] EMcsm"u ;t&t#;r @ Aft#x}u}jPuu jx u#ց!rXxtR99u2yr,9Yv'QRtu$Vu uPuuu Q҃ u uu$Puuu Q 3@_^[]jhx%uN@ uNhF P豁YYt7F N@Cg5 33@ËeEËVW >t1t G P@;r6]&Y|_^Ã=u[V5W3u<=tGV{YtujGWyYY=L tˋ5SBV{C>=Yt1jSxYYtNVSPr t3PPPPPZ>u5]%'3Y[_^5L \%L UQMS3VU 9Et ]EE>"u39E"FE<tBU PFYt} t M E FU Mt2}u t utBe>< t< uFN>}t EE3C3FA>\t>"u&u}t F8"u 339EEtIt\BuU tU}u< tK< tGt=Pt#9Yt M E FM E  YtFU FVtBU ME^[t ËU S3VW9uhp VSt 5\ ;tE8uuUEPSS} E =?sJMsB;r6PvY;t)UEPWV}E H@ 5D 3_^[ËUx  SV5W33;u.֋;t x #xxu jXx x ;u֋;u3f9t@@f9u@@f9u5SSS+S@PWSSE։E;t/PBuYE;t!SSuPuWSSօu uYY]]W\t;u;r8t @8u@8u+@PEtY;u VEuVW` V_^[ËVW;stЃ;r_^ËVW;stЃ;r_^ËUQQVFV\|W}S99tk ;rk ;s99u3t X]u3u `3@N`MM N`H p=t;}$k ~\d9=ptB߃ ;|]~d=u Fd^=u FdN=u Fd>=u Fd.=u Fd=u Fd=uFdvdjY~d`QӋEYF`[_^ËUcsm9Eu u PYY]3]ËUeeSWN@;t t У`VEPTu3u3<33EPE3E3;uO@ u 5։5^_[ËU 3ʼnEjEPhuEu EPeYM3RËU43ʼnEEME؋ESEЋVE܋EW3M̉}};E _5LMQP֋t^}uXEPu օtK}uEuEu uutYF;~[wSD6=w/u;t8-WWuujuӋ;u3P`Y;t E}9}t؍6PWu荐 VuuujuӅt];tWWuSVuWu t`][9}uWWWWVuWu Ӌ;tuESP Pj?uESP Pj@uSEP PjAuESPP PjBuESP PjCuESP Pj(uESP Pj)uESPkP PjuESPP Pj uESP8 PhuESP Ph ]SEjPP _[ËUVuvnJvfJv ^JvVJvNJvFJ6?Jv 7Jv$/Jv('Jv,Jv0Jv4JvJv8IvVjWEjPEFPjWEjP EFPjWEEjP< Et VY뎋E0|9 0@8u7;u~>u @E DH HuHE3AEt5tP֋tPօuFFYYEEE3_^[ËUVut~F ;LtPLFYF;PtP:FYF;TtP(FYF;XtPFYF;\tPFYF ;`tPEYv$;5dtVEY^]ËUSVuW3}u}9~u9~u}}@6j0j1aYY;u3@uj`YE;u S{EY89~j`YE;uSXEuPEY҉8v8C PjVEjP蝾CPjVEjP艾 CPjVEjPu CPjVEjPaP CPjVEjPJ C PjPVEjP6 C$PjQVEjP" C(PjVEjPP C)PjVjEP C*PjTVEjP C+PjUVEjPϽ C,PjVVEjP軽P C-PjWVEjP褽 C.PjRVEjP落 C/PjSVEjP|< t$SSDuCuCQC0|9 0@8u#;u~>uj Y@Eu IK@MC3@39}tM;tP;t#PuBC7CYYEE3_^[ËUES3VW;t} ;w_j^0SSSSSAE Ù+‹E<7E01kYYu M9 }Nu ^;] ~_^3Ʌ[]ËU 3ʼnEVtS>tNhcVYYt=hcV YYujEPj wt/uViYM3^2Y3_^]jhX sEu= = 3;|; r!=8= WWWWWɋ  L1tPPY}D0tuYES= ME Eu_PYËUEV3;u=VVVVV6@^]ËUVuF ttv f 3YFF^]SVWT$D$L$URPQQhd53ĉD$d%D$0XL$,3p t;T$4t;v.4v\ H {uhCECEd_^[ËL$At3D$H3Uhp pp> ]D$T$UL$)qqq( ]UVWS33333[_^]ËjE33333USVWjjh+ Q٤_^[]Ul$RQt$ ]UEf@@fu+EH]ËU9EuIjP;M u.:YYu3]ËEPu 7% Qy: t҉&3@]ËUEVuu%P4Yt E߃^]ËUf;Et]O]ËUWuMYf;tjWC!YYuf_]ËU@3ʼnEMEV3W} @$Dž^4;u :VVVVV8s;tuƅ#8f;)SjP3{ YYtA$8$8YPYYGGjP? YYuJj%Yf;f;W ,ƅƅ!ƅ+ƅ?ƅ"ƅ3ƅ*3GGu,P2Yt, k DЉ,N*tzFItLu~*Of6uGf84uuf3u Gf82ubfdt\fitVfotPfxtJfXuB+:ht)lt wt?#Gf8lt*3 *3?+u03ƅ?ufSt ƅ3fCuƅ3 ntRct{t$8$8JY4f;< t , oq c jdX;] %g~Jit!n+8 & 4j-Xf;Lƅ!Hj-X3f;4u fC j+Xf;4u!,$8IY4 u,44PZ/Ytz,,tjf4fYP@PCS  $8#IY4tPDž.0Pr74;,,$8H4ffYP@PCS 44P .Yty,,tif4f XP@PCS>  $8GY4ujeXf;4tjEXf;4x,,djeXfYP@PCS  $87GYj-Y4f;u.QXfYP@PCSS  j+Xf;4u3,,u!,$8FY444Ph,Yty,,tif4f XP@PCS $82FY4u$84YY+3t6VfY0Y]FPVW3V L;tt"u VVVVV<P*WHP5臆YWGYu,Dž 3~ƅ"$84YY t,,$8DиY4f;tctUsuf r f Zf u:{K‹3ۃC㋍3؋+"fFFÃpJHH@t34f9#+ 3~ƅ"Gj^GXf;u ƅu#h .YRDžh jTN j]Xf;uPG^G@ Gj-YGf;uYftTj]Zf;tIGGf;sf;w++@ʃBNu䋝3ƒj]Yf;of?rj+Xf;u0,u t ƅ?$8BY4j0Xf;$8lBYjx^Ɖ4f;t\jXXf;tTDž9t& t,u?Džon$8SYYj0[L$8A Y4t,,}? RjVP?t"t "r3PPPPP-^MGGF$8R,YY;+7c("t3fƅ*4j-Xf;u ƅ!j+Xf;u0,u t ƅ?$8@Y؉4c?xtrptiP5&You'j8Xf;^jj xO?PP&YtuSY4Ã0 t,t4$8?Y4$8SRYY!؃ى?xt:pt1P$Yt~ou j8Xf;vm*k %u_P#%YtQSmY4 Í|t,t4$8>Y4Z$8SIYY!t߃Fu+u8tF*t>f>#GGYYL}ɀp@2%3 t-F]0F$xOFۃ3'3 u!0OF uU E1FFE 9UuM܋ OMw;UE}~MW#UM#ECf0f9vËMmEFMf}EM}f}|QW#UM#EBfv1FftFu0H;E t9u: @}~uj0V@ uE 8u}4$pWFJB3%#+ESYx ;r+F -F;Ӌ0|$;rSQRP%A0FU;u |drjjdRP@0UF;u | rjj RP@0UF]0F}tE`p3[_^ËUSVWu؋sMNu-!j^03PPPPP}tE`p}v̀}t;u u3;-0@;-u-wC3G X0F} ~DCE[F}&ۀ}u9] |] } Wj0V0? }tE`p3_^[ËU,3ʼnEESVW} j^VMQMQp0>3ۃ;u SSSSS0ZE;vu 3Ƀ}-+uMQMQP3}-P=;tuESVu`M_^3[ËU03ʼnEESVu Wj_WMQMQp07>3ۃ;u SSSSS8+M;vދEHE3}-<0u +ȍEPuQWd<;tXEH9E|-;E}(:t Gu_uEjuuuEjPuuuM_^3[ËUEet_EtZfuu uuu u ]ÃatAtu uuuu u0u uuuu uwu uuuu un]ËUjuuuuu uZ]ËVW36rY(r_^ËVhh3V+> t VVVVVb^ËUd]d]EuMm]]z3@3hdthdP|tjSW3D$ }GT$ ڃD$T$ D$ }T$ڃD$T$ uL$D$3D$ 3OyNS؋L$T$D$ ud$d$r;T$wr;D$ v+D$T$+D$ T$Oy؃_[SVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[U}}M f$ffGfG fG0fG@fGPfG`fGpIuЋ}]U}E3+3+u F;F uOVYt.VYt"VV< YY0@$-ƅpݽ`aAuƅp- uS uN uu tƅp-u t Xݽ`au- tƅp-ƅp u--ٛݽ`aAuݽ`aݽ`ٛu ٛt øVtV$$v=ft^t̀zuf\?f?f^٭^L剕lݽ`ƅpa$؃#zuf\?f?f^٭^L剕lݽ`ƅpɊaݽ`ɊaŊ$׊$ ؃#۽bۭbi@tƅpƅpD۽bۭbi@t ƅpƅp۽bۭbi@t ۽bۭbi@t ƅpƅp-0pƅp tËT$fT$l$ét@nËB%=tËB D$B  D$ $,$ BËD$%=tËD$f<$t,$Zf$f=tf tf t Z,$ZÃ$D$%$D$%t==t_f$f=t*f u!f tt{Z]Z,$Zln\ns |ndnTnv tnUEEEEE UE]MEMEMEMPQRH Ef}tmËU~93ʼnEE V34809uu3;u'0VVVVVSW}4 NJX$('tu0Mu&30}VVVVVC@ tjjjuX u4YDd@l39HP4 `39 tP43<9EBD'g (3  ǃx8tP4UM`8jEPKP5Yt:4+M3@;j@SPU CDjS@P1 3PPjMQj@QPCD\j^^N 3_@[3^]ËU}t'Vu F tV0f f&fY^]øø`ËUSVu3ۉ];t9]u3{v3fW} ;uSSSSS<uM?E;9XuH9]vM9ff8tAFFM;Mr8]tE`pE8]tE`puVjW=j p;xzt*3fEu E;t'M:tMQP+YYtF8t!F9]uu+u uEVu jp;uTM*3f-9Xu WY1SSjWj p;uR*8]tE`p H8]tMap_^[ËUSVu 3ۉ];u9]t*9]wj^SSSSS0#3fW};tuME;EvE=v jPMQPuVu;t3f8]tkMapb@;tH;Ev<}t,3ffj"^SSSSS08]tE`p&EEP3fLF;t8]tE`pE_^[ËUjuuuu u]ËUQQE VuEEWVEY;u NjJuMQuPE;uxt PYϋ D0 EU_^jh lu܉uEue J Ƌ3;|; r!;8! WWWWWAȋ  L1u&8 WWWWW[PSY}D0tuuu uE܉U 8MME E܋U3luYËU8hYMAt I AI AAAAa]ËUEu 3]V3;|; rVVVVV 3ȃ D@^]ËU3ʼnESVu F @W6V\Y0t.VKYt"V?V< /YYÊ@$$<VYt.VYt"VV< YYÊ@$$<VYt.VYt"VV< YY@t]uEjPEPt]39}~0NxL=AD=VP91YYtG;}|fE Fx Ef EVP9YYM_^3[á39 ËUSVu 3;t9]t8uE;t3f3^[uME9XuE;tff8]tE`p3@ʍEPP%YYt}E~%9M| 39]RuQVj pEuM;r 8^t8]eMapY;*8]tE`p:39]PuEjVj p:뺋Ujuu u]ËUSVW?Qe= hy*5|hyWօPP$tyW PtP$`yW P_P$DyW PJPY th,yWP2PY  ;tO9 tGPP5 PYYt,t(օtMQj MQjPׅtEu M 9 ;t0P@PYt%ЉEt ;tP#PYtuЉE5  PYtuu uu3_^[ËUMV3;|~ u( EVVVVVe^]ËUuMuuuu }tMapËUQQ3ʼnE SVW33G;u,VVWVӅt= /xxu jX  ;;u#9uu E@EVVuu ӋȉM;u3~Ej3Xr9D =w|;tP\Y;t 3;tuWuu Ӆt VV9uuVVuujWVuWYuuuu e_^[M3\ËUuMtuEuuuu P}tMapËUE ]jh deu uE/EE3=Ëe}ujeEEd̋UMMZf9t3]ËA<8PEu3ҹ f9H‹]̋UEH<ASVq3WDv} H ;r X;r B(;r3_^[]̋Ujh!hdPSVW1E3PEdeEh*tUE-PhPt;@$ЃEMd Y_^[]ËE3=‹ËeE3Md Y_^[]ËU3@}u3]USVWUjjh(Mu`]_^[]ËL$At2D$H3 UhP(RP$R]D$T$SVWD$UPjh0Md53PD$dD$(Xp t:|$,t;t$,v-4v L$ H |uhDID_뷋L$d _^[3d y0MuQ R 9QuSQ SQL$ KCk UQPXY]Y[ËUE ]ËUfEf0s]f:s0]ùf;`f; f;s+]ùf;s f;rf f;[ f;rɹ f;C f;rf f;+ f;r f; f;rf f; f;ef f; f;I f; f;-f f; f;Pf; f;f;rs f;Pf;r]*f;@f;rC f;f;r+ f;0f;rf;v]ËUuMBE MUTu}tMA#E3t3@}tMapËUjjuj]ËUj ju2 ]ËUU VuWHFw  yBw t;t_+^]ËUSuM39]u.SSSSS8]tE`pW} ;u+wSSSSS8]tE`pUE9Xu Wu:YY4VEMQP@ EMQP. G;t;t+^8]tMap_[ËUV395u09uuVVVVV9u t^]Vu u ^]ËUS3VW9]uMS9]u.{SSSSS8]tE`p} ;t˾9uv(j^0SSSSS_9] v݋U;ӈ~3@9E wj"Y;0F~:tGj0Y@J;M;ӈ|?5| 0H89t>1uA~W6@PWV=3_^[]ËUQU BSVW%#ωE Bپ%ut;t<($3;u;uEfM XL<] ME HuP ɁPtM _^fH[ËU03ʼnEES]VEWEPEPYYEPjj ufZ3uЉCE։EԉCEPuV$t3PPPPPmM_s ^3[WVU33D$ }GET$ڃD$T$D$ }GT$ڃD$T$ u(L$D$3؋D$d$ȋd$G؋L$T$D$ ud$ȋD$r;T$wr;D$v N+D$T$3+D$T$My؃ʋӋًȋOu؃]^_̀@s sË3Ҁ33j]YËUEM %#Vt1W}3;t VV(<YY j_VVVVV8,_uPu t ;;YY3^]ËUUVujXEU;u S3;|;5 r'SSSSS QW< ƊHuV< jwP];9] t7@$EHjYtHuШtUE EШu!SSSSS4M;rEu2YE;u hjSSuzD(ET,AHttI tl9]tg@MED 8]tNL% tC9]t>@M}ED% u$L& t9]t@MED& SMQuP4{M;p;MgMD};t M9 u ]EÉ]E;M<< t CAMEH;sA8 u AAM uEmEjEPjEP4u xuE}t?DHt} t ML%;]u} tjjju} t CE9EGD@uC+E}EK xC3@;]rK @0t0u C*zA;u@AHt$CQ| T%Cu T&C+ؙjRPuE+]Pu SujhEu4xPYME;E tPYEEE3;EL0;tMf9 u ]EÉ]E;Eff tf CC@@EM;sHf9 u Ej MEjEPjEP4u xu[}tUDHt(f} tj XfMLML%D& *;]uf} tjjjuf} tj XfCCE9Et@uffCC+]]xj^;u< D0imY]\3_[^jhx!EEu 3;|; r!0 VVVVVɋ  L9t;MAu0{PYuD8tuu u~ EE M0ME EDuJYËU(3S] VuW}EEEEEEEE9 t5 L-YLM;t[jY+JJtqJtE EE\zM]Q]]YA"EXzM]QE]]YjEEXzEPz]]"MEPzrELz׉MELzZE\z놃tNIt?It0It tEDzEmm(mmmmmUQQEQQ$5YYuHEQQ$a5]YYDz/EQ 3Q]E$<5]YYDzjX3@3ËUVU33EAu9Eu=9UuzAEu9MuB9Uu=z Ez 3F9E u&9UuUvUAEtZT9M uY9UuTEQQ$YUYzuUAuuE؋^]l$l$D$5t0uËD$ %tg=t`|$D$ ?%D$ l$ D$%t @ @l$ D Dl$ËD$ D$uËD$ %u|$D$ ?%D$ l$ D$%t=t2D$s*D$r H|$l$ɛl$l$Ã,?$,Ã,,Ã,,,,,|$ <$|$ l$ Ƀ,Ã,<$|$ l$ Ƀ,Ã,|$ <$|$ ^l$ ,<$|$ J,|$ <$:l$ ,|$ <$&,|$ <$|$ l$ ʃ,Ã,<$|$ l$ ʃ,Ã,|$ <$|$ l$ ,<$|$ Ƀ,|$ <$l$ ,|$ <$Ƀ,|$ <$|$ jl$ ˃,Ã,<$|$ Kl$ ˃,Ã,|$ <$|$ $l$ ,<$|$ ʃ,|$ <$l$ ,|$ <$ʃ,|$ <$|$ l$ ̃,Ã,<$|$ l$ ̃,Ã,|$ <$|$ l$ ,<$|$ h˃,|$ <$Tl$ ,|$ <$<˃,|$ <$|$ "l$ ̓,Ã,<$|$ l$ ̓,Ã,|$ <$|$ l$ ,<$|$ ̃,|$ <$l$ ,|$ <$̃,|$ <$|$ ~l$ ΃,Ã,<$|$ _l$ ΃,Ã,|$ <$|$ 8l$ ,<$|$ ̓,|$ <$ l$ ,|$ <$̓,|$ <$|$ l$ σ,Ã,<$|$ l$ σ,Ã,|$ <$|$ l$ ,<$|$ |΃,|$ <$hl$ ,|$ <$P΃,Ã,<$|$ ;,Ã,|$ <$(,PD$%=t3%8t D$XɃ <$D$,$Ƀ Xt$XPD$ %=t3%8t D$kXɃ <$D$V,$Ƀ Xt$XP%8t D$/XɃ <$D$,$Ƀ XP%8t D$XɃ <$D$,$Ƀ XPD$%=t3%8t D$XɃ <$D$,$Ƀ X|$XPD$ %=t3%8t D$~XɃ <$D$i,$Ƀ X|$XP%8t D$BXɃ <$D$-,$Ƀ XP%8t D$XɃ <$D$,$Ƀ XP,<$|$ ,XP,|$ <$,XPSQD$5 LpD$%=\D$.%M=BD$,6D$*D$%?\$0+w^D$% \$0+l$(D$\$0+؃+ˋ؁ ˉL$l$D$|$(ul$|$|$4D$4 ?D$8l$8D$%\$0+؃? ˋD$\$0% ؉\$l$l$(%u |Ƀu\$0|$(l$-l$(l$4t l$l$(tV|$<t|$4D$4 D$8l$8 ll$4D$YYt=u V6Yu6+YM_3^薤][ËU3ʼnEV395tO=u,upVMQjMQPug=uxxuω5VVjEPjEPVP tVURPEPQtfEM3^أUQVu VE F Yu N =@t "tfNF F feSj[ ÉF u,d ;t X@;u u yYuV%YF WF>HN++ˉN~WPu M EN F =M tt 0@ tSjjQ#ƒt-F]fjEPu ]f]ջ E9}t N %_[^ËUVWuMnEu 3;t0;u,WWWWW詥}tE`p39}t }|Ƀ}$ËMS}~~EPjPmQM BtGǀ-uM+uGEKB$9u*0t E 4vБODUt3ʼnES]VWu}fUʸ#ȁ]EEEEEEEEEEEE?EMftC-C u}fu/u+u'3f;$  fCCC0S3@f;3@f;ut@uhxzQftu u;hpz ;u0u,hhzCjP 3t VVVVVC*h`zCjPa 3t VVVVVC3qʋiMCkM 3fMۃ`EfUu}M} pۃ`EET˃gk MMf9r}ĥEĥMƉEP 3ɉMMMMM3u##֍4 f;f;f;?f;w3uuu3f;uGEu9uu9uu 3fEf;uG@u 9pu90t!uuEMUɉU~UL MEEEVȃe ;r;sE}FtfEmM}EFFEM}f~;Eu-EMe EE EffMf}BEtEMuUm M HuMu9EtfMf9MwMu4}u+e}uef9MufEGfEEEf;33f9EEEIM3;{M?f;E3҉UUUUUɋ3##Ё4 ]f;Lf;Cf;5?f;wK3EE9fE }fEEEEEf}V33f9uH%E\3f;uFEu9Eu9Eu fEf;uFEu9Eu 9EvE}EEMM~JM؉MDM eʋW ;r;sE}_tfm@@M}GGEM}f~7}x+EMe E? EffMf}BEtEM}Um M H}Mu9EtfMf9MwMu4}u+e}uef9MufEFfEEEf;r#33f9EEEIM;fE ufEEEEEfu3feH%eEEUE}ft2+3ff9EB$  BB0B^~j_u?3fEEE]Me ؋E M]Eu؅}2ށ~(E]Mm ؋E N]E؍GZ]EUEu}ĥe}e ʋU ֋4  U ȋE <;r;sF3;rs3BtAEȍ0U;r;sAM ʍ4?uuM0 CM}uEKKK<5}MD;9u 0K;]sE;]sCf*؀ˈXDEM_^3[À;0uK;sE;s3ff9U@ʀ P0@3t@tttt t˺#Vt#t;t ;u  ˁt u  ^t 3tSVWt t t t t Njʾ#t;t;t ;u ` @ _#^[tt ;u Ã@ @ËUSVW}]3tjZttt ttˋ #ƿt$=t=t;u #tut} M## E ; Em}]3tjZttt ttˋ#t(=t=t ;ututU 395}]Eyj^tttttȻ`#t* t@t ;u@#ǃ@t-t @uE#E# ;uPEYY]M3҄yjZttttt#t$= t=@t ;u  #σ@tt @u‹3M E t _^[ËUQQE]EËUE#f;u-EQQ$HYYtHt Ht3@]jjX]ø]%fuE u}t ]]Dz @]%]ËUQQEEM] fEEËU3ҁ} u 9Uu3@]Á} u 9UujX]ËM#f;ujf;uE u9Utj3]ËUUDz3U3ukE u9Mt]]Au3@3e EtM eJEtVf!u^;t f EEQQQ$ "QEQQ$ E]ËUEMSVW3xE3ۉxECx t E XEtEHEtEHEtEHEtEHEu E3H1HE3H1HE3H1HE3H1HE3H#1H+tMI tMI tMI tMI  tE X  #t5=t"=t ;u)E!EE E #t =t ;u"E E EEM31E X 9} E}t&` EEXE X`E``EXP4H H EEXE X`EH`H`EXPEPSju$MAt&At&At&At&Yt&ߋ3+út/HtHt Hu( % % !+tHtHu!#  # 9] tAPAP_^[]ËUjuuuuu u]ËUESV3ۋCut]tS2YtEtjYvEjEY #tT=t7=t;ubM {LHM {,2M zM zE3tW} DEPQQ$M] } E (SS]Au3ҋEfE;}"+]tum]tMmHutE]E_tjYeuEtE t j Y3^[ËU}t~}"]!]ËUQ}EËUQ}EËUQ}E M#M #E E m EËUQQMt -]t-]t -]t ؛ t]jh!39tVE@tH9t@EU.E=t =t33@Ëe%eUEeU3PPjPjh@hzáV5ttP֡ttP^ËU3ʼnEESV3WEN@0pp9u FX}𥥥< ыH Ή}e ˋ] ׍<0PH;r;sE3ۉ89]tr;rs3CptAHHU3;r;s3FXt@MHe ?< PU މxX4U;r;sE}0tO3;rs3BHtCXM E} 3&HP EH9ptջXu00xE04? H ʉpHtfMfH M_^3[Wu%8%<%@%D%L%P%T%X%\%`%d%h%l%p%t%x%|%%%%%%%%%%̋tPZVtPGD$^L$^VtP^}p̸3ĉ$f(V$ hL$ jQfD$tT$hRu3^$3sVYuۍD$PH$^3̸sVW|$ f?tUPuf9u;t7ft*Quf>.ufffu3f_3^̋D$w$Xøøø@FRĹ 3ĉ$$0S$,U$4VW }|$h3L$LWQD$ j|$D$;tP5$4T$RD$PQ|$bSjVkUjVbT$RjVUL$VPQ&T$R;tVD$;tP$,_^][3q 3W|$t,j\W tfxtfGfu_Vt$tj\V˪uf^3fH^́,3ĉ$(SVW~|$$3hD$vSP\$f衰$L L$QT$(RP\$ L$SQD$ ;tPD$T$ RP\$;z$<D$ L$Q$0RjPD$,$,\$\$Pff;u+$,Qh~T$,hRtpD$ ;tP$@D$PL$(QR\$>D$SPD$;tPT$L$QR\$ t\;tCj!h}SV$,PjVVhWVñ;tV$,Qh}.T$RD$;tPRD$;tPDD$ ;tP6L$D$ PQ\$Y;T$R?D$ ;tPD$;tP$4_^[3#o,SUl$VWPIffu|$+ЋǍpffu+DPY~؃tfӋ+׍f fuŋffu+ƒfOfuT$ȃL$ QSRjSs_^][́3ĉ$$V3;f90Ph( D$hPt$t$nD$;tP$L$QT$RPt$ukL$VQu\D$;tP}D$T$RPt$u7D$;tPXD$;tPJ^$3ymËD$;tP!D$;tP$^33Em̋D$HyuIHyt̋D$yud$ytV>upFxt@Fxte^pyu Axu$ȋAxtN^Ë@xu$N;uFЋBxtNyt^*pF^VhD$t Vi^̸ 3ĉ$ $ S$( U$$ Vf5(W$0 h$"jQD$ l$$f$(]hT$.jRft$4GjD$h8jV$$ h,UP_L$QSWhiu(T$R?tD$$$ h$PQWjVhSjV_T$RjVRUjVO\$$$ D$P$ QSUD$ ($ff;uftfPf;Qufu3uCT$Rt&D$PL$QSU_SjV3Rh Uh~jVVhU:VTVNtV $ _^][3;j ̋D$ L$T$PQhR̋D$ L$T$PQhR̋AWxuSL$SVO Ӎf1f;2uftfqf;rufu3Ƀ}Nj?t^[_̋T$BV0r0~uVrpI^;Qu ABJ;u BAB̋L$T$D$ PQR ̋L$T$D$ PQR jlt.L$T$L$ HL$PP IT$HP@SVW|$ًuFP6We~t_^[jQltHtHt@@Vt$D$t;D$tkD$ ;D$t L$^́ 3ĉ$f(VhL$ jQfD$/$8hԀVM=upT$Rjjj.jt5=@t.P$,hXPX 3^$3Mg ÍL$Qc$,T$RhԀPhhhԀV$$ ^3̸f ́3ĉ$ =tV$hVD$ TuhVB;$WhhhVJhh>P|u,jX$tQhPVhhV?D$PjjjjׅL$QhV |$ thV_t{f(hD$jPfT$=L$QhT$hReD$$PhhVo,L$QhVH.hTVOD$rhhV/ ^$ 3̸Aejh{dP(ذ3ĉ$$VW3P$4d=2$HhV$Dhh̃Wf(hL$BjQfD$HT$$RD$LPhVWD$8x^,L$bL$0QDŽ$@GT$T$RL$D$.bjD$ su&hpWL$DŽ$<a3QD$ PVL$ dVhh<WVhWVthL$DŽ$<a$4d Y_^$$3c4jhdP,(3ĉ$(SUVW3P$@d$\3D$8|$($H|$$8$PhPƄ$P|$$|$8pPff;u+p 6Qir؃\$4;u $XRhpVSbD$8;tP_$TD$(PSQ|$4;T$(WR];D$$3;tPL$(D$$PQl$,<;cL$$T$0RD$ PjQV;/D$;tPff;u+tl$$TT$Rh؆PƄ$Tl$ ;L$hІQ͡;IǍPffu+-j؅tU9WjS\$,T$SRK^D$tP L$D$PQD$ (u D$,8jCD$tPWjVt$$T$,$XD$MUjPL$T$,D$QRP|$,UWu$XhQ $XhPR_D$HhІj舠l$(D$PEtU D$tPD$Ƅ$HPD$;tPD$;PtSD$tPD$ρL$4Qfd=l$4$T$PT$,RD$@Ph(SQD$@}YD$PPff;u+7ȄPIff;u+x?Rnt$4;u :$XPhȄWV"_L$(PVS;L$(UQ;t$(L$$jPV;L$$T$0RD$ PjQSD$FP$ffu+'3|$|$|$ L$Ƅ$H$TPh؆RG;jTPL$$D$\$ PjS-L$SQt$L$PVjT$$T$PRUPU EjPL$L$T$QjR$XD$OWjPyL$D$QRPXYL$$PWQhPRD$HD$$PL$Ph0UL$SQt$L$$PVucL$$T$0RD$4D$ PjQ+QtSjD$tP\D$Ƅ$HtPFD$.tS.D$tP D$Ƅ$HtP t$(L$$PV,m3u3|$89/~.$X$TT$ R$THPQRoD$0D$43;t P}`D$;t Pl`D$$;tPxD$(;tPjƋ$@d Y_^][$(3[8ËD$;tP2D$;]jhXdP0SUVW3PD$Dd3l$3ۉl$L\$ l$D$ThPD$TD$=|$$D$(lD$,TD$0@D$4 D$8D$<l$@;tPT$XL$QhxRl$ ;j؉\$ l$WjS;uD$SPf;unD$;tP(T$L$QRl$ K;t2u?L$SPQ2;u(T$TWh8R D$|(@D$;rD$;tP;tSD$;tPƋL$Dd Y_^][׋$f0f;2uftfpf;rufu3}\${oL$T$ztAx:uYL$ W Íf0f;2uftfpf;rufu3}|$?tL$T$D$ _^h]HP [jhdP|$3ĉ$x$SUVW3P$$df(h$jQf$菕 jD$$)D$$$$$T$ R$PhLUSDŽ$$D$4Oh*hhUh8h=h$U4=}3Iffu荄$fHfu  PH P f HfPD$(P$QOxWaVWj$R[OD$$PL$QhؑVD$$0OT$BhPh$hQTT$$RD$P$QVNtT$RID$HhQhP$hRXTD$$PL$Q$RVNtD$Ph,SV Tth h Sh h@hUL$0Q$RhUSD$DM p$h~$6jPf$0ffu$+ƒfOfuȃth,hTS D$@3(ffu=D$ $$|$T$L$,QRjP'L$$Q$RPL$8QD$4謔u7$Rh$hTSM$PhDS:l$jhjVtL$,QjVgWjVdVhSV*tVD$|$$RhȏhHhoOu hȏhȎB$Ph$Qh=Ouh$R hȏ$PhThDSJ$$thh$$hhhDUtt=[tD$tPChthDh\U9hLhDh0U$hhDhUhhDhȍU@hhDhUh`hDhLU =3 $ffu荄$fHfu 48 <P@H DP fHHfP$Ptth$hSVh,hSUSUSUSD$rtPp3$$d Y_^][$x$3OĈ$ÃSUl$ VUt$uSW{D$t;tS;_t;N Eff;uftfPf;Qufu3|L$  CL$D$L$D$ I^]H[UjhdP(SVW3PEdeM$3EE]] ˋ]M]W}VWPEhpP*oMjQ~E hURPEc` MjEbpMu7]PjwMWjxu]PjwM$u]PjwMRME\PMhQfhu M\PjwMu\PjywUMjRjrMEREEEtHȃ8ujҋEEEtHȃ8ujҋEMd Y_^[]EC̃SVWD$$PL$Q u0x Xt;tP;u-T$ RL$D$p}4HhP#D$PD$h}Qu]P;~uSPOB_^[6̋D$VPXHh}^̃SVWD$$PL$Q 0x Xt;tO;u-T$ RL$D$p}GhP#D$PD$h}UPuO;~uOOB_^[6̃SVWD$$PL$Q 50x Xt;tWO;u-T$ RL$D$p}FhP#D$PD$h}OuO;~uOOB_^[6̃SVWD$$PL$Q 0x Xt;tN;u-T$ RL$D$p}dFhP#D$PD$h}5OuN;~uNOB_^[6jhdPDSUVW3PD$XdrLj3hL$D$4t$0D$ pD$PL$4t$dwhL$4QD$8@NT$tGt$pjRPVP~];D$ut W]L$9KuwtƉCjWgC\A ;Cupuw>K SBM9YuAK9uAKHK;tT$8ZE;x8_;ueFxuXVFyFxut8YuP8ZtaH8YuZP@x=FNH^PV͈Z.txuXVFG=xuH8Yu8Zu@Ev;xK18YuPZP@NH^V͈Z<_D$P_CEvHED$lL$tUHL$\d Y_^][T ̃ SUًCVp~WD$uXD$$8N Ǎff;uftfPf;Qufu3D$t6v~t t$|$tUS2t;tIL$;u.D$$PUjQ_ȋD$I^]H@[ t$|$T$$ F ff;uftfPf;Qufu3}D$$L$PUQT$ R넋D$ 8_p^]@[ ̃SVFW|$t;t >H|$9\$ ufL$$^t;t H|$9\$(uFNQRF@FFF@FD$_^H[$t;|$$t G|$\$ ;\$(tL$ SWD$P,|$Ƌ6D$_0^X[jh8jdPQV3PD$ dt$jGt03D$F@F@FF@FƋL$ d Y^jhdP V3PD$dt$FPQRQD$PD$0GNQ"@RFF @L$d Y^̃D$SUVWPL$Q|$\$l$L$D$$T$$RD$(PWSUQKT$(WSURD$ PD$$_^][jhldPV3P$dh$H$DŽ$d$$tAL$8jjhh$P$Ƅ$d$0tAL$D$PL$(J$hD$PQƄ$kS L$jƄ$ecT$jRqt$ L$Ƅ$!PPjjL$ h(jjL$ hjjL$ hjjL$ jjkL$ jjkL$ hjjL$ jjpkD$ L$jPje$L$OPh|YD$ Ƅ$D$tHȃ8ujЋD$Ƅ$D$tHȃ8ujЍL$Ƅ$fEL$,Ƅ$蕃$Ƅ$DŽ$ tHȃ8ujЋ$DŽ$DŽ$tHȃ8ujЋ$d Y^Ul$ljh dPSVW3PEdeEt3WPMTQ}DJ` }9}XtLMXUdR]\E9}hu9EXEdEET ;tHȃ98uSҸCMqCpEbCMEVCMEJChMhHMhEe\;tY袊hhUhPMhEe\;tY}PM\hԗhMhHMhe\;tY}PMhlUhPMhe\;tYhhlMhHMhEe\;tY}Pp蝀hhlUhPMhe\;tY|PM[MhhE(PQ)O M,WE )_ULjRnmuPME KPSfMPh(jfMPhjfMPjjygMPh(jzfuPpKPjbfEPM,WPjauPMxKPS?fMPh(j0fMPhj!fMPhjgh(MPjfuPM(KPjeMPWQM,j?aMXh|LR{jWPME k}LE ,AM$KMhHMhe\;tY UXPMXe\;tY?MXh|EPPMENME @uXMGJPhuXM4JPhpV[Uh hpM0QR#M M4WE#]E8jPhkuME>MEv>jEdE@j,PނPME葚,E>jcjQωE\覂PMEYE>jE@$EKtK/tExMtPQR/t.ME?>ME3>ME'>p.u8]KtxUxEtRP.uduXMGPhV:Y `=ME=Eu4MQ`I8]bupRM5Ebt2h,UR`}cuEPMEcBhhlMhHMhe@tAtwPMzM\UREPQURUhEPEX`QRP EDtuXMFMDQPhV.XME<`E<`EtGu jЋEE}tHȃ8ujЋE.D$D$t ,:3D$u'jhL$%hD$ PD$R.L$d Ỹ j-t ؘ jhL$}%hD$PD$-̃ j~-t  jhL$-%hD$PD$-D$Vt Vn&^̃ j-t  jhL$$hD$PD$;-̃ j,t ( jhL$m$hD$PD$,D$VИt V%^̃ jN,t @ jhL$#hD$PD${,̃ j+t X jhL$#hD$PD$+,D$Vpt V$^̃ j+t x jhL$=#hD$PD$+̃ j>+t  jhL$"hD$PD$k+D$Vt V.$^̋@|VD$t V#^̃ j*t u'jhL$<"hD$PD$* UjhdPHSVW3PEdeMȋ} 3jW]]]Љ]]܉]؉]̉]PײEԍE PMQjW] Q;EЋu;t(PVQ7@;thV菼ZjU REPjWV] .;EM QURjWP] ;M QURjW] ;bUE PMQjWR] ;>E PMQjW] v;MU REPjWQ] ;u];t&ƍPff;u+;tUE܋MRUPEQRPh&MU܋EQMRUPQRVXE؃PEM̋ERPQVҋjE;NE=t)=t=t EEEEԛhE r3;u$jhMhEPE(MRE PW҄u2E @E PW(;t9M} WEPBЋ}t΋UEMWRUPQhR1tMThMQ'Eȋ@M؋UPQh8RE[CËu3ۋ,Eȋ@MUPQhRE[CË}E;t Pt'E;t Pd'E;t PT'E;t PD'E;t P4'E;t P$'E;t P';t W'ƋMd Y_^[]D$VLt Vn^̋@|TLVD$t V/^̃ j%t u'jhL$|hD$PD$% UjhdPHSVW3PEdeMȋ} 3jW]]]Љ]]܉]؉]̉]QPEԍE PMQjW] ;EЋu;t(PV2@;thVϷZjU REPjWV] n;EM QURjWP] J;M QURjW] ;bUE PMQjWR] ;>E PMQjW] ;MU REPjWQ] ;u];t&ƍPff;u+;tUE܋MRUPEQRPh&MU܋EQMRUPQRVSE؃PE[M̋ERPQVҋjE;NE=t)=t=t EEEEԛhE .;u$jhMhEPEN#MRE PW҄u2E @E PW$;t9M} WEPBЋ}t΋UEMWRUPQhRqtM hMQ"Eȋ@M؋UPQh8R]E[Ëu3ۋ,Eȋ@MUPQhR+E[Ë}E;t P"E;t P"E;t P"E;t P"E;t Pt"E;t Pd"E;t PT";t WG"ƋMd Y_^[]D$Vtt V^Vj脨D$PjVi^̋@||øtVD$t V?^̃ j t u'jhL$hD$PD$ ! UjhdPHSVW3PEdeMȋ} 3jW]]]Љ]]܉]؉]̉]aP'EԍE PMQjW] ;EЋu;t(PV-@;thV߲ZjU REPjWV] ~;EM QURjWP] Z;M QURjW] ;bUE PMQjWR] ;>E PMQjW] ;MU REPjWQ] ;u];t&ƍPff;u+;tUE܋MRUPEQRPh&MU܋EQMRUPQRVNE؃PEM̋ERPQVҋjE;NE=t)=t=t EEEEԛhE );u$jhMhEPE^MRE PW҄u2E @E PW;t9M} WEPBЋ}t΋UEMWRUPQhR聰tMhMQEȋ@M؋UPQh8RmE[ Ëu3ۋ,Eȋ@MUPQhR;E[ Ë}E;t PE;t PE;t PE;t PE;t PE;t PtE;t Pd;t WWƋMd Y_^[]jh{dP3PD$dj^D$D$t N3D$u'jhL$hD$ PD$rL$d Yjh{dP3PD$djD$D$t O3D$u'jhL$dhD$ PD$L$d Yjh{dP3PD$dj>D$D$t R3D$u'jhL$hD$ PD$RL$d YVD$t V^VHD$t V^VhD$t V^VD$t V^VD$t V^VD$t Vo^jh"dPSV3PD$ d u9 h|x D$hx 8t$ u8  hp|p D$hp S8t$ u5 h4h \$ahph 8t$ u8  hP|` D$h`` 7t$ u9 h@|X D$hPX 7t$  u8  h{P D$h@P ĘI7t$@ u8  h|H D$ph0H 7t$ u8  h|@ D$Kh @ 6t$ u4  h{8 \$h8 ~6t$ u8  h0|0 D$ h0 496t$ u8  h0|( D$ h( L5t$ u8  h| D$ [h d5t$ u8  h| D$ hЯ j5t$  u8  hl D$ h %5t$@ u8  hl D$h @4t$ u8  hl D$h h4t$ u8  h& D$h V4t$ u8  h{ D$=h 4t$ u4  h{ D$hp 3L$ d Y^[ UjhXdP8SVW3PEdeu3;uhTS-SVRuh(hV8} WV۷#jhE]]]܉]]Љ]̉]ȉ]ԉ]]WVE谴 E;tP辚EPhXW]MSQĚUR蹚E;tP|EPhW]貚MSQ肚E;tPCEURP]i;u,MSjQ胚\UERjPHtD=9MQURSWV蝫WVKhVեM芚PhWESP輙3ۋuMSPV訙;zEMQURjPEMQURjPiEMQURjP;KM܋UEQMRPh|3Qu };]EtftbǍPffu+tKÍPffu+t5WUME RPQΉuu'EsU܋ERWSh8P蠤ESUt*pffu+t MRhQ RUhRT E Ëuԅyjj=u$E MPQ覶uU ERPu} E;t PE;t PE;t PuMQ趗UREPhWV]ĉ]U؋;u.;t7pff;u+tM UQRU؃;t R E;tPE;tP E;tPNjMd Y_^[]̋D$Pj:jhdPVW3PD$ d|$W踖t$VWD$tVvNjL$ d Y_^ S\$UVW|$?u3l$t$tT$D$PQUR芖ut$F6PQtt3뽃?uju _^][3f_^][SUVW|$?u D$ L$ 1l$L$T$RPUQt$,؋D$t;r p6RPtL$ 1뷃?uju _^][3f_^][́T3ĉ$P$XVL$QPV$T3^3! TQduLVh/h/dP|tD$PPօt D$d^Yád^YjhdPVW3PD$$d33=`%|$L$8D$ PWWQ|$<|$t4T$4h R*D$;tP2L$$d Y_^$ÍD$Ph(L$$QL$T$ RD$(PjQV=t;uFF FF|^|>̋D$Q@AfAfAfAfAVD$t V^Vt$ s 2^A;Au.A;A u&T$+f fu^}PdPKP2t$QhRV8B3҃fF^Vt$W|$ D$ MEL$;~^ ?+yttم}|$D$ D$ l$ \$ fD$ ȋǙl$_^;}D ?+Q$|$ D$ D$ _l$\$fT$l$ f^_f^̃83ĉD$4S\$@Vt$HWD$ PT$RD$PD$Pffu+x;s0IQD$PS> 3fK>_^2[L$438D$Ӌ+If fuL$@_^[3̰j8Vt$ > Ws _ 2^G;Gu/O;O u'T$ +f fu_^kd  r jPЃ r L$ j QjPփRk8 _^̋A$̋D$L$T$ ` 3 ̋L$T$D$ PBQP ̋L$T$D$ PBQP VFtPF^̋D$L$T$ ؤ VN(=9Ft^^QVW|$D$PN0QjWD$u4T$RD$ F4PjWuL$Q8VjWD$_^Y jhKdP3ĉ$SUVW3P$(d3fD$E8tT$+f fuE4tyL$qffu+t#|$fOfu t8Ѝffu|$+ƒfOfuȃ󤋜$8tUu =t%U0txffu+tE T$RVP$LPuU L$QVRh8Uh$,jPDŽ$0!; D$φt$$<L$Q$(RVPDŽ$@蝆U $$QWRhU tVË$(d Y_^][$3&  ̋D$L$T$  Q=Vt3^Y S\$W|$D$ PN0QjWSD$ HuT$ R4VjWSD$ +_[^Y D$VDt V^̋L$H$3LHHHH HH H VFLt PFt PFt PF t PD^jhdP,SUVW3PD$@d3|$|$H|$|$(D$Pt$XED$H|$ Pff;u+LQE ;u ΋ff;uT$TEUL$,QT$8RPL$8Qҋ؍PIff;u+͋XPIffu+Ћƍpffu+46PAL$\Q͉|$<PSVWD$,tPDET$RWPD$$uUD$XRPPD$,D$P/]D$3;tPT$L$QR|$;D$,3҉|$T$$t&L$QT$(RPD$ PP;T$$tSXIffu+t-=Rt IcL$TQ T$$OGR%tgL$0T$RT$EPQRD$,utT$4D$D$PD$MQRPuOD$MURPEQPҋhhVhXU\$ D$8t Pot SbD$(tPn3D$;tP^D$;tPPƋL$@d Y_^][8 }uPhU9 }uPhԧU Pffu|$X+ЋǍpffu+46PWhVSL$zMPSQ݀T$PR誀t$L$CPV蘀ujD$jP螀M ]t3} u t#D$TL$PPQu E b3E XuWhhU F NhhPQ臁^ËκIff; uftfHf;Jufu3u)V RhXVF N h,PQ~^3^ËF NSWT$ RV^SPQRD$ t'x$ffu+to=u_NV@ SQRЅu. V FQRP2~ V Qh4RhV ]F hPhV?;N RhQhTVUV hRhV[NV@QRW_[^jhȥdPQVW3PD$dt$ h4M3N(|$ 9/~4~0~8ƋL$d Y_^jhdPQV3PD$ dt$ F4D$t PF0t PF8t PCN(D$.L$ d Y^hd,B(V,^jjh(dPQV3PD$ dt$hN(D$L/ƋL$ d Y^jh(dPQV3PD$ dt$LD$N(/L$ d Y^jh(dPQV3PD$ dt$h>N(D$l(ƋL$ d Y^jh(dPQV3PD$ dt$lD$%N(L$ d Y^jh(dPQV3PD$ dt$h~N(D$X.F0F4ƋL$ d Y^jh(dPQV3PD$ dt$F0D$t PF4t PN(- L$ d Y^jhpdPSUVW3PD$(d3ۉ\$l$8U\$4yD$\$$\$8PD$0҉D$Pff;u+ЋFxff;u+<?P؃\$ u4D$8tP)yD$tPyD$tP yZNT$QRWSED$$tPxL$D$PSQD$ yD$D$؃u>jD$ L$ u _^][ T$RP_^][ jTL$ tʹffuVPUhxRdx_^][ ̃=VupF L$ T$WPF~(WQRPuBv0t'ƍPd$ffu+t L$_13^ { T$_3^ F4L$_3^ ́$3ĉ$ $,$0$(UVD$D$PT$jT$RED$t .D$"3Pffu+DPt$uFL$ffuSWhV0 ؃Iv QtSRouÍPffu+tCt&P)t3f;suÍPffu+Cf:t f\T$(+$f fuD$(Pffu+f|D&\t|$(fGfut$t_ƍPffu+tIƋ֍ffu|$(+ƒfOfuȍD$(PHthj؃tL$UxL$Q3_[L$Q_[Ƌ$(^]3A$ ̃43ĉD$0L$8Vt$DD$PjT$ RHD$u;D$QhT$jRD$ P3^L$034 u?D$HQRhD$jPL$ Ql3^L$03w4 ^L$03`4 L$4^3̸I4 QD$PjL$QL$jueD$tt Y Vt$t;ƍPffu+r!Ff\tf:uL$V3^Y ^Y Y QD$PjL$QL$u*D$tt Y $L$RR3Y Y ̃ D$PjL$QL$T$Vt@pffu+t(R}L$ T$T$RD$ 3^ D$tuNt$tFf>tP%uf9uV}L$QL$ D$ T$3^ ^  QD$PjL$QL$uRT$ t Vpffu+^uD$tt Y $L$R3Y Y VL$@QV RNQL$ VRT$ QL$ RT$ QRЉF^̋D$tQD$tQD$ tQ A VFtPF^̋D$S\$ UVWPffu+3@ Ql$ FŃPffu+3@ Q|$$FǃPffu+3@ QbVF ffuV͍d$ffuV ffuD$$_F^][VFPBNQ9V R0 ^VW|$ ;uoGNPQuMWFRPu9O V QRu%F:Gu33҅_^3ɄL 3҅_^_^D$Vt V^̋D$Hy%uIHy%t̋D$y%ud$y%t̋@@V^̋D$T$ VPD$L$QL$RPQ]^̋D$P VHQHRPQRP.^̋AVp~%Wu$S\$SN Btv6~%t[_^̋T$BV0r0~%uVrpI^;Qu ABJ;u BAB̋T$Vp2p~%uVrpI^;Qu APBJ;Qu APBPBV>uAFx%t@Fx%te^&y%u Ax%u$ȋAx%tN^Ë@x%u$N;uFЋBx%tNy%t^F^V>uFx%t^Hy%ux%u Iȋx%tN^Ë@x%uN;HuFЋBx%tF^VxD$t V^j(atHtHt@$@%UjhdP SVW3PEdej(uEuEt/M EU]N~ SωVCMGN$F%ƋMd Y_^[]URjj̃SVWD$$PL$Q 0x Xt;t;u-T$ RL$D$p}hP#D$PD$h}uu;~uOB_^[6̃SUl$ VU^؉\$uW~D$t;tv;_t SuL$ FL$D$L$D$ I^]H[SVW|$%ًu&FP6O W~%t_^[jh8jdPQV3PD$ dt$jt03D$sF@%F@FF@FƋL$ d Y^jhdPHSUVW3PD$\dD$tx%tLj3hdL$ D$8t$4D$$D$PL$8t$hhLL$8QD$~];D$u%t W[]L$9Kuw%tƉCjWC\A ;Cu%puw>K SBM9YuAK9uAKHK$$;tT$8Z$E;x8_$;ueFx$uX$VF$Fx%ut8Y$uP8Z$taH8Y$uZ$P@$FN$H$^$PV͈Z$Ntx$uX$VF$x%uH8Y$u8Z$u@$Ev;xK18Y$uPZ$P@$N$H$^$V͈Z$(_$L$ D$PCEvHED$lL$tUHL$\d Y_^][T jhdPDSUVW3PD$Xd rLj3hL$D$4t$0D$ D$PL$4t$dhL$4QD$8@T$tGt$pjRPVPG_;uhG(Oi"|$lt .G;0u(nG;puhUz$E$Q; uQRz$uY$Z$JA$r;qu VVFX$NQB$FHQ{z$uY$Z$JA$r];1u VZFX$NQB$F@HPz%uBPQW;BuJP;u JHNy$FWBX$D$hhL$Xd Y_^][P̃SVFW|$t;t ^|$9\$ ufL$$^t;t >|$9\$(uFNQRF@FFF@FD$_^H[$t;|$$t |$\$ ;\$(tL$ SWD$P\|$Ƌ6D$_0^X[̃ SUVW}w~%D$u)IL$$F PD$t6v~%t܋u߉\$t$tYMt;t7;u2T$$RWjD$ P_ȋD$I^]H@[ L$\$t$T$$RK tD$$L$PWQT$ R맋D$ _0^]X@[ jhdPHSUVW3PD$\d$\$|l$xD$tL$pWSUPQL$DT$0RD$(P D$l0H L$T$ t;5 t"D$ 9D$t$uL$;NuT$r [6D$lPL$xT$tWSUQR#D$0PL$HUt$XL$DQT$(R D$lL$DL$0ƋL$\d Y_^][TjhdP V3PD$dt$FPQRQD$PD$0NQRFFL$d Y^{jhdP SUVW3PD$ d|$G7D$(t$l$_t;t;t9u1;nuM tjҍL$l$t$뵋6ЋD$(L$ d Y_^][V8^5jh8dPVW3PD$d|$H|$@D$$tT$0L$HQPD$4jRPD$\ucL$4T$HQRL$ofD$DL$t$ D$u/t+P1T$@tT$QRPb L$ gD$HtPƋL$d Y_^ VD$t Vo^VЯ^ЯjhdP83ĉ$4SUVW3P$Ld$h$l$p$\$`3ۉD$$$tl$0T$4\$]$T;;xff;u+!8$xtT$RPSQV\$,;T$SSSSD$$PL$\QSR\$@D$4\$H\$L`;D$ D$D$HPh;|$,;w ;l$(/D$$Pff;u+Ƅ$T8$xtL$QPD$ ST$TRP\$0t'D$D$$T;PL$$T$QRL$@ct$8Ƅ$T;L$8dPQL$8Ƅ$TxdL$$T(D$|$,|$0 QRl$0;L$4D$L$Hff;uD$L$ SSSST$$RT$,D$\PQR`;qu)3FL$8D$Ƅ$Tc;tl$0E;t PD$4]D$;tPƋ$Ld Y_^][$43D VD$t V^Vh^eS\$UVW3|$0;tt$T$L$0QPWVR|$D;uf3ftIf\uLF@fu+PL$(tL~ffuT$,D$0tP_^][ V(D$t V^̋VD$t V^VF^VFt P^VWGt Pt$ ƍPIffu+ƍPffu+3Ƀ QEG΋ffuǍPIffu+f|G\t(fGfu_^G_^̋APMSUiVWtōPffu+3\$ x;rt$VUl$U 3fDu9;_3^][t T$3f 9;_3^][VHD$t V课^VF^VFt P(^VWGt Pt$ tKƍPffu+3@ QvG΋ffu_^jOG3_f^̋A̋QUl$ VWtMpffu+Ep;rt+S\$VRSm 3fs[G9}_u^]3σ}t T$3f G9}_u^]VD$t V/^UQ8MEuHVWft0E } ftf;t GG7fuf?t AAfuf9Mt:E u ft9f;t FFfuf>u AAf9u3fAAEHE+#E_^ËUES] f;WtDft:+ËM ftft++uAAf9uf9tGG@@fu3_[]ËU S39]u )SSSSSIE Vu;t!;uSSSSSsEBuu=?v EEWEPSuEP;t5Mx EE EPS\YYMxE EPSDYY_^[%%%MT$BJ3ŐMT$BJ3谽 ̋MMM M0T$BJ3_d̍M XM鐻T$BJ3(̋T$B J3w̋T$B J3W̋T$B J3ȼJ3込-̍MT$BJ3萼4̋MMmM bMM6<+M#Mp饶`,Mܳ<M陭P龳T$B 83cJl3YTȶ̍MȭMM鸭MM8MpMh|MMEM=M5M-M%MT$B x3­Jt3踭'̍LMLLMlT$3VJ3IP鸵̍uj_TT$3J3X̍MXM鐫MHM逫 <4ԱtɱM鑫MɪM遫M鹪M鱪D閱M鎱d郱M{TpMxXMMeMMT$B 033T̍MXM鐪MHM逪MȪMPڰMҰM險Mҩ`ǩ鬰@顰閰鋰 0uM=MuZhODM MDxM1 XT$B 3蚪3荪D̍MM0M騯M頯MةM鐯T$B |35J3+隲̍MXT$B J3J3\e̍M\hM M8MTPM(M 逨MHȨMTEd edM0ÍMϮMM(鿮T$B J3gֱ̍M阮T$B J3@J36t饱̍teM]MUT$B p3J3_̍MMMT$B J3谨4̍MحMЭT$BԋJ3x̍M騭MpM騦M頦M鈭M逭T$BJ3(J3銰̋M ^M,^T$BJ3 Q̋M e^T$BJ3譧L̍MMPMȬMMM0l饬T$B h3JJ3@鯯̍MhM}T$BJ3w̍MM0x%T$B h3ʦJ3X/̍MMMثMЫMȫMM鸫M逥M鸤|魤钫釫T|$qDf4[PlEl:T$B 3ߥJt3եD̍8M֕˕M飿M雿M铿d鈿H}邪w(lT$3J3p̍MؗM MMMMT$B J3訤̍M8M0PMȩMM鸩M鰩M騩M(M(M 鐩T$B J38Jx3.(靬̍MXMPMHM@M8M0T$B |3գD̍*zMM鹽M鱽M驽d鞽T$3PJ3C4鲫MP鸢M1hpYh4>hߜYhL>h远Yh`>hlh蚜Yht>hhzYh>h0hZYh>hXLh:Yh>hlhYh>hLhPYh>hhڛYh>hh0躛Yh>h h蚛Yh>hHh@zYh?hphZYhЮNYQD$PL$Q +h)̹0Tf选̡ԾоtHȃ8uj̹̹̹̹fjh:dP3PD$dD$ 0.L$d Y jhjdP3PD$dD$ L$d Y jhdP3PD$dD$ L$d Y jhʔdP3PD$dD$ L$d Y jhdP3PD$dD$ L$d Y jh*dP3PD$dD$ HL$d Y jhZdP3PD$dD$ NL$d Y jhdP3PD$dD$ XNL$d Y jhdP3PD$dD$ NL$d Y jhdP3PD$dD$ pNL$d Y ̀=t6 t, t jjhʞdP3PD$dD$ nSL$d Y ,p̹ F̹ F̹ F̹ 6F̹ E̹ E̹ D̹ 6E̹( D̹0 D̹8 D̹@ D̹H fD̹P VD̹X D̹` C̹h C̹p C̹x C̹ v12:~000000011<1L1l11111122,2J2f2X:F:J0<0,00 0/$::b3x33333334.4F4^4v44444444455*5<5L5b5r555555556,6J6^6p6|66666666677.7B7\7t7~777777777888.8<8N8\8n88888889$949H9`9p99999999h:22z::22d0:&3<33N/:g1J ts}yv0qF@Ҩƨ0PpЩ0PpЪE|r-[2 -sHKLM\Software\MicrosoftDesktopFolderProgramMenuFolderStartMenuFolderCommonFiles64FolderCommonFilesFolderSystem64FolderSystemFolderProgramFiles64FolderProgramFilesFolderWindowsVolumeWindowsFolderNIDIR__SUBSTRING_CONTAINS:.91D5760B_F9E8_4332_BFB1_38A4CB799A3ECallwisepatchCallwiseapibad allocationNIVersion.NIMetaUtilsCA.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENIBuildDate.NIMetaUtilsCA.91D5760B_F9E8_4332_BFB1_38A4CB799A3ENIProductPartSOFTWARE\National Instruments\Common\Installer\ProductsSOFTWARE\National Instruments\Common\Installer\PartsProductCodeProductNamePackageCodeProductLanguageUpgradeCodeProductVersionSOFTWARE\National Instruments\Common\Installer\DependenciesNIDependencyNIPartDependencyNIPatchTargetNIMETAHOOKDLLPATHNIMETAHOOKFUNCNAMESOFTWARE\National Instruments\Common\Installer\MetaHookDLLPathFuncNameSOFTWARE\National Instruments\Common\Installer\MUCustomExecute#1#0NIMUCA_EVAL_COND.DirectoryFileRegistryNIMUMainFeatureName.91D5760B_F9E8_4332_BFB1_38A4CB799A3EXذX  @`PP ~%sNo dependency information found in this Part - nothing to do - done.%sBoth or either %s and %s tables not present - no 1.1 dependency info found.%sFound 1.1 dependency information - done.%s%s table has no rows - no 1.1 dependency info found.%sEntering subroutine... GetDependsTableRev: %u.%u.%u.%u%u.%u.%u%u.%u%u@#p0x0'''''''P''''''''''''''!p`@PP   @#4̴0P'P--%&&'`; 'P&%p&0'@'String Memory Alloc Failedd)PPf)(((Registry%sERROR - the called function threw an unexpected exception!!!%sComplete!%sAbout to call function...%sCannot find function %s (GetProcAddress returned %u) - exiting!%sCannot load %s (LoadLibrary returned %u) - exiting! ExecuteMetaHook: ProductLanguageVersionUpgradeCodeNIMURegistry\@Q?#%uRegOpenKeyEx failed: %dIsValidSecurityDescriptor failed: %dSetSecurityDescriptorDacl failed: %dNew DACL is invalid: %dlooped AddAce failed: %dAddAce for new ACE failed: %dInitializeAcl failed: %dInitializeSecurityDescriptor failed: %dmalloc for new SD failed: %dmalloc for new DACL failed: %dPermission already granted to specified userGetAce failed: %dGetSecurityDescriptorDacl failed: %dGetSecurityDescriptorControl failed: %dIsValidSecurityDescriptorRegGetKeySecurityRegQueryInfoKey%s failed : %dRegOpenKey@Q?L@Q?@Q?*bad castinvalid map/set iteratormap/set too long@Q?OmegaString position index out of bounds.@@Q?Attempt to assign mismatched IOmegaStringCOW derived objects.%sNo MetaHook entries found or are empty - nothing to do - done!%sFound MetaHook entries in registry: %s=%s and %s=%s - done! CheckIfMetaHookViaRegistry: %sEvaluated condition '%s' to %dConditionEval%sError - Bad Condition field of '%s' in table '%s' with Feature_ key of '%s'.Condition#%dAttributesLanguagesVersionMaxVersionMinNIFeatureSubsetFeature_ WriteDependsRow: %sNo dependency mismatches found -- very good!%sError - missing value '%s' in %s.DependencySELECT `Dependency` FROM `%s` WHERE `Dependency`='%s'SELECT DISTINCT Dependency_ FROM %s WHERE Type=1%sAbout to check if both 1.1 NI depends tables match up on the Dependency key column. VerifyNIMU11DependsTableGood: TARGETDIRNIMU FeatureSELECT Feature, Feature_Parent, Title, Description, Display, Level, Directory_, Attributes FROM FeatureNIMUFeatureFeatureVersion9XALLUSERS%sMSI error: %u ( %s )%s%s table has no rows - nothing to do - done!%s%s table not found - nothing to do - done!%sStarting action...%s%s[%s%s][#%s]%sNo MetaHook MSI properties found - done.%s.%sUniquified%sFound MetaHook MSI properties: %s=%s and %s=%s - done! CheckIfMetaHookViaProperty: %sLeaving subroutine.NINoticeFileComponentKeyNIMDFPatchManifestDirComponentKeyNIMDFManifestDirComponentKeySELECT Feature_, Component_ FROM FeatureComponents%sFound and using feature "%s" for component to go under.%sCreated feature "%s" for component to go under.SELECT Component, ComponentId, Directory_, Attributes, Condition, KeyPath FROM ComponentNIMUComponent%sCreated Faux ComponentId %sComponentId{%s}Component%sCannot find product code!!!ProductCode GetNIMUComponentFeature: WriteNIMUProductList: Error - empty Product code, name, or version - exiting. WriteNIMUProductList: Leaving subroutine.%s\%s\%s WriteNIMUProductList: Recording Part ProductCode: %s SELECT ProductCode FROM %sProductOrderCategoryCompanyEnumVisibleName%s\%sSELECT `Registry`, `Root`, `Key`, `Name`, `Value`, `Component_` FROM RegistryNIPRODUCTORDERCATEGORYNIARPVISIBLE10NIARPCOMPANYENUMNIUpdateProductVersionNIUpdateProductCodeProductVersionProductName WriteNIMUProductList: Entering subroutine...%sError - Bad table revision parameter value!%sError - empty Product code, upgrade code, version, or language - exiting.%sLeaving subroutine - complete!%sWARNING - Wise bug of having multiple values in ProductLanguage property detected (ProductLanguage=%s), please fix!%sNow writing out the parent UpgradeCode and Version.%sWrote %d rows of dependency information.%sFYI, found no revalent dependency information to persist!%s\%s\%s%dDependsInfo%sWriting row %d for Feature_ = %sSELECT Feature_, UpgradeCode, NIFeatureSubset, VersionMin, VersionMax, Languages, Attributes, Condition FROM %s,%s WHERE Dependency_ = Dependency AND Type=1%sError - There are one or more rows in your %s table that do NOT tie to a dependency in the %s table.%sError - Null input parameter! WriteNIMUDepends: %s%s table not present or has no rows - no patch target dependency info to write.%sWrote %d rows of patch target dependency information.%sWriting child part %d to Product Part table for Patch Target Part = %s%s\%s\%s%sPatchTarget%sWriting reverse dependency %d for Patch Target Part = %sSELECT ProductCode, ProductVersion, ProductLanguage, UpgradeCode, CorePartProductCode FROM %s WritePatchTargetReg: NIMdfClientAdeRegSOFTWARE\National Instruments\Common\Installer\MDF\ClientADEs%sRegistering ProductCode %s%s: Error - Null input parameter!%s: Starting action...WriteMdfClientAdeInfo%sError - %s must have a value - exiting.%sAbout to get propertiesNIMURegPartInfo: %sBuild date=<not found>%sBuild date=%s%sVersion=<not found>%sVersion=%s%sCompleted Custom Execute %sSpecialIdentifierCustomExecuteTypeCmdLineNIExecutable%s\%s.%s%sRegistering Custom Execute %s%sError - Name must have a value - exiting.%sError - CmdLineFormatted must have a value - exiting.%sError - NIExecutable must have a value - exiting.%sFetching custom execute type 3: '%s', '%s', '%s', '%s', %d, '%s', %dSelect `NIExecutable`, `CmdLineFormatted`, `Condition`, `Name`, `CustomExecuteType`, `SpecialIdentifier`, `Attributes` FROM `NICustomExecute` WHERE `CustomExecuteType`=3%sError - empty Product code - exiting.NICustomExecuteNIMURegisterMUCustomExecute: %s No NICustomExecute rows that match - nothing to do - returning%s Error: this condition is bad - aborting!!!!%s Evaluates to: %d%sFound condition %s on row %s%sEmpty condition - nothing to do for row %s - continuing to next one.Select `NIExecutable`, `Condition`, `CustomExecuteType` FROM `NICustomExecute` WHERE `CustomExecuteType`=3%sNo NICustomExecute table found - nothing to do - done!%sError - Couldn't get dbPtr??? - exiting.NIMUEvaluateNIConditionColumns: %sSetNamedSecurityInfo did not set permissions for path '%s'. Return code %u.%sSetNamedSecurityInfo did not set permissions for '%s' because this location does not exist. (Return code %u)GetAce from SDDL failed: %dUSERSMACHINECURRENT_USERCLASSES_ROOT%sError - GetSecurityDescriptorControl failed for '%s'.%sError - ConvertStringSecurityDescriptorToSecurityDescriptor failed for '%s'.D:(A;CIOI;KA;;;AU)D:(A;CIOI;FA;;;AU)SetPermissionsForType: Error in NIPermissions tableNIMUSetPermissions encountered restricted key '%s' while processing NIPermissions table part: '%s' primary key: '%s'.NIMUSetPermissions encountered restricted registry key '%s' while processing NIPermissions table part: '%s' primary key: '%s'.USERS\MACHINE\System.AppUserModel.StartPinOptionSELECT MsiShortcutProperty, Shortcut_, PropertyKey, PropVariantValue FROM %sSELECT Shortcut, Directory_ FROM %sNIFORCENONPROGRAMSTILECLEANUPNational Instruments%sCan't get the path to the Start Menu Programs folder!%s%s table doesn't exist!%sError - Couldn't get pDb - exiting.MsiShortcutPropertyShortcutNIMUManageWin8InstallTiles: %sError - NIPathsEnvironment table has empty required field(s) - exiting.][_ENVIRONMENTSELECT Environment, Name, Value, Component_ FROM EnvironmentSELECT `Property_` FROM `NIPathsRequested` WHERE `Property_`='%s'SELECT `NIPath_`, `ComponentId_`, `Name`, `Attributes` FROM `%s`NIPathsEnvironmentNIMUProcessNIPathsEnvironmentTable: %sNo MetaHook information found - nothing to do - done!%sThe hook executed and returned %u - done!%sError - The hook executed and returned %u - exiting!NIMUMetaHook: %sFatal Error: Unspecified problem in WriteNIMUProductList custom action.NIMUPersistProdList: NIMUEnsureCorrectFeatureState: MSI Error %d: %sNIMUEnsureCorrectFeatureState: Complete!NIMUEnsureCorrectFeatureState: Set feature %s to action state %s.NIMUEnsureCorrectFeatureState: Feature %s currently has action state "%s".SELECT `Feature` FROM `Feature` WHERE `Feature`<>'%s'NIMUEnsureCorrectFeatureState: Property %s has feature name "%s"NIMUEnsureCorrectFeatureState: Property %s not found or empty, so no feature to enable. Done!NIMUEnsureCorrectFeatureState: Starting action...NIMUEnsureCorrectFeatureState: %sFatal error in dependency information processing- terminating.NIMUPersistDepends: %sFatal Error: Unspecified problem in WritePatchTargetReg.NIMUPersistPatchTargetRegNIMUPersistPatchTargetReg: %s: MSI error: %u ( %s )%s: Complete!%s: Fatal error in MDF Client ADE info - terminating.NIMdfClientADENIMUPersistMdfClientAdeInfo[%s]%sError - Unrecognized root value %dHKEY_USERS\HKEY_LOCAL_MACHINE\HKLM\HKEY_CURRENT_USER\HKCU\HKEY_CLASSES_ROOT\HKCR\HKCURRENT_USER\CLASSES_ROOT\%sError - Registry key not found '%s'SELECT `Root`,`Key` FROM `Registry` WHERE `Registry`='%s'GetRegistryPath: %sFatal Error - Unspecified problem in GetNIMUComponent custom action.NIMUPersistPartRegInfo: ,; %sError - Bad type field of %s%sSetting registry permissions.%sSetting file permissions.%sSetting directory permissions.%sCondition evaluated to false, skipping.%sError - Bad Condition field of '%s'%sProperty not requested in this Part, skipping.%sProcessing '%s' table row with primary key '%s', location key '%s', formatted location '%s'.SetPermissionsForLocation: Language %s %s found in the %s set {%s} Version %s is %sin range %c%s,%s%cexclusiveNOT inclusiveSELECT `NIPermissions`,`Type`,`LocationKey`,`FormattedLocation`,`SecurityDescriptor`,`Condition`,`Attributes`,`Comment` FROM `%s`NIPathsRequestedNIPathsPermissionsSetPermissionsForTableEntries: LanguageVersionString%sThere was an error setting permissions for NIPathsPermissions table entries - ignoring the error.%sThere was an error setting permissions for NIPermissions table entries - ignoring the error.NIPermissionsNIMUSetPermissions: %sMSI error: %u ( %s ) while processing product code %s Adding PC %s to property %s for upgrade.;%s Found PC %s for UC %s%sFound composite patch with UC %sProcessCompositePatchDependency: %sExecuting new NIFindRelatedProducts code for removing composite patches.%sSkipping old NIFindRelatedProducts code PC %s is already listed in property %s. PC %s our own product code. Skipping.%sExecuting old NIFindRelatedProducts code%sProcessing UC %sSELECT `UpgradeCode`, `VersionMin`, `VersionMax`, `Language`, `Attributes`, `Remove`, `ActionProperty` FROM Upgrade%sNo Upgrade table. Exiting.Upgrade%sOld NIFindRelatedProducts code not needed on Windows 7 or higher. It will be skipped.NIENABLENIFINDRELATEDPRODUCTSVersionNTNIFindRelatedProducts: .Cstring too longinvalid string position@5'SELECT `Name` FROM `_Tables` WHERE `Name`='%s'SELECT * FROM `%s`SELECT `Value` FROM `Property` WHERE `Property`='%s'<Null MSI Database Handle>MSI Database Handle: %d (%s),@;`;8):| while deleting database Unrecognized INSTALLSTATE ValueDefaultSourceLocalAbsentAdvertised or RemovedBrokenUnknownInvalidArgumentMoreDataSourceAbsentIncompleteBadConfigNotUsed8@`; E[1](on active MSI)MsiSession ObjectMsiSession Object opened on %s0G`;K<Null MSI View Handle>" on (Queried "MSI View Handle: %uع0O`;0U from %d (%s)MSI Error Record Handle: MSI ViewInfo Record Handle: MSI View Record Handle: MSI Record Handle: <Unable to read record>'[%d]' <Null Msi Record Handle>MsiTableInformation Object for table %s%s%dSELECT `%s` FROM `%s` WHERE `%s` = '%s'.(`iW0Zx{W`w-_{%S}Global MsiInstaller ObjectȺxy occured while <Unable to format error record.>InstallerErrorx64{,{''Windows Error MDFOtherReferenceFirmwareAPIUtilityRun-TimeDriverToolkitModuleApplicationADEPatchLegacyFavorLastLegacyFavorFirstVS2005MSIEngineDotNetEngineOEMARPNIARPSoftware\Microsoft\Windows\CurrentVersion\RunSoftware\Microsoft\Windows\CurrentVersion\RunOnce|-l-P-<-,--(,,,,, ,,x,ph,X`,@L,(#8,',,*$,.WideCharToMultiByteMetaToolbox: Passed NULL string to %sMetaToolbox::RemoveLastSlashkernel32IsWow64Process\..\..\@П0 л`  `  @Њ<@WMetaToolbox: Dynamic library function %hs was not loaded from library %s.Ћ@ Input path %s has a leading backslash; leading backslashes are not supported: %s Input path %s is longer than MAX_PATH: %s Input path %s is NULLܽ (P t  MetaToolbox: Error in %s functionMetaToolbox::StrictPath::StrictPathMetaToolbox::StrictPath::operator +MetaToolbox::StrictPath::Compare?_tfullpath_tchdir_tgetcwd Parameter pathToAppend is NULL Parameter fullPath is NULLMetaToolbox::AppendPathMetaToolbox::StrictPath::IsAbsoluteMetaToolbox: Dynamic library %s was not loaded. Path is missing a backslash after the drive letter: %s Path has an invalid drive letter: %s Path has a trailing backslash but is not a directory: %s Path has invalid character at index %d: %s Invalid path - wild character at index %d not allowed: %s Invalid path - must be relative: %s Invalid path - must be absolute: %sstrPathMetaToolbox::StrictPath::AssignMetaToolbox::StrictPath::ChangeAttributes Path too long: current length is %d; append length is %d; MAX_PATH is %d First path does not have directory attribute StrictPath does not support appending with/to P4 paths. Cannot append '%s' with '%s' StrictPath does not support getting parent directory of P4 paths %sMetaToolbox::StrictPath::GetParentDirectoryvector too longMetaToolbox::StrictPath::operator =MetaToolbox::StrictPath::operator +=pathToAppendMetaToolbox::StrictPath::AppendNISHAREDDIRSOFTWARE\National Instruments\Common\Installer kernel32.dllshlwapi.dllpsapi.dllEnumProcessModulesCopyFileExMoveFileWithProgressPathAddBackslashGetVolumePathNamePathIsRelativePathRemoveBackslashUrlEscapePathIsUNCGetModuleHandleExPathGetCharType$@X'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''00@@ > [%f] @@NI_MetaToolbox_MetaOutput_GetSharedGlobalDatap 0@P` p 0@P`p0 @ P0`` p0@@@000deque too long MetaToolboxError: '%s' missing MetaToolbox resources! Project for DLL needs MetaToolbox.rc in its resource includes. C Runtime function %s returned an error. Error code: %dWriteFile failed while trying to write message to debug log:PrintfV failed while trying to write message to debug log:Call to GetNextUserLogMessage not allowed when LoggingMode is set to OutputUserLogMessages.Resource id not valid: %u%1Resource id could not be loaded because resources are not available: %uWindows function %s returned an error. Error code: %u    0HF Error in %s: pStrBlock should not be NULLMetaToolbox::DeleteStringBlock malloc returned null - out of memory! String index invalid. Index: %u; Strings per block: %u pszStrSize cannot be NULLMetaToolbox::GetStringLockResourceLoadResourceFindResourceEx strId: %u; LangId: %uError in %s. Module Handle: %uMetaToolbox::LoadStringFromResource Parameter pszStrSize is NULLXUnknown exceptionl S csm  ((((( H h(((( H H  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~LC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALL@RL4RL(R?RRR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_.,._;==;aVisual C++ CRT: Not enough memory to complete call to strerror.HEncodePointerKERNEL32.DLLDecodePointerFlsFreeFlsSetValueFlsGetValueFlsAllocruntime error TLOSS error SING error DOMAIN error R6034 An application has made an attempt to load the C runtime library incorrectly. Please contact the application's support team for more information. R6033 - Attempt to use MSIL code from this assembly during native code initialization This indicates a bug in your application. It is most likely the result of calling an MSIL-compiled (/clr) function from a native constructor or from DllMain. R6032 - not enough space for locale information R6031 - Attempt to initialize the CRT more than once. This indicates a bug in your application. R6030 - CRT not initialized R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data This application has requested the Runtime to terminate it in an unusual way. Please contact the application's support team for more information. R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point support not loaded Microsoft Visual C++ Runtime Library ...Runtime Error! Program: JUbad exceptionCorExitProcessmscoree.dll HH:mm:ssdddd, MMMM dd, yyyyMM/dd/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSununited-statesunited-kingdomtrinidad & tobagosouth-koreasouth-africasouth koreasouth africaslovakpuerto-ricopr-chinapr chinanznew-zealandhong-konghollandgreat britainenglandczechchinabritainamericausausukswissswedish-finlandspanish-venezuelaspanish-uruguayspanish-puerto ricospanish-peruspanish-paraguayspanish-panamaspanish-nicaraguaspanish-modernspanish-mexicanspanish-hondurasspanish-guatemalaspanish-el salvadorspanish-ecuadorspanish-dominican republicspanish-costa ricaspanish-colombiaspanish-chilespanish-boliviaspanish-argentinaportuguese-braziliannorwegian-nynorsknorwegian-bokmalnorwegianitalian-swissirish-englishgerman-swissgerman-luxembourggerman-lichtensteingerman-austrianfrench-swissfrench-luxembourgfrench-canadianfrench-belgianenglish-usaenglish-usenglish-ukenglish-trinidad y tobagoenglish-south africaenglish-nzenglish-jamaicaenglish-ireenglish-caribbeanenglish-canenglish-belizeenglish-ausenglish-americandutch-belgianchinese-traditionalchinese-singaporechinese-simplifiedchinese-hongkongchinesechichhcanadianbelgianaustralianamerican-englishamerican englishamerican`ENU`ENU`ENU`ENA`NLB`ENC`ZHH`ZHI`CHSt`ZHH``CHSL`ZHI8`CHT(`NLB`ENU`ENA_ENL_ENC_ENB_ENI_ENJ_ENZ_ENS|_ENTp_ENGd_ENUX_ENUH_FRB8_FRC$_FRL_FRS_DEA^DEC^DEL^DES^ENI^ITS^NOR^NORx^NON`^PTBL^ESS<^ESB,^ESL^ESO^ESC]ESD]ESF]ESE]ESG]ESH]ESM|]ESNh]ESIX]ESAD]ESZ4]ESR ]ESU]ESY\ESV\SVF\DES\ENG\ENU\ENU\USA\GBR\CHN\CZE\GBR\GBR\NLD\HKG\NZL|\NZLp\CHNd\CHNX\PRIP\SVK@\ZAF4\KOR$\ZAF\KOR\TTO\GBR[GBR[USA\USA  6 - 0OCPACPNorwegian-Nynorsk(null)(null)EEE50P( 8PX700WP `h````xpxxxxccsUTF-8UTF-16LEUNICODEe+000~PAGAIsProcessorFeaturePresentKERNEL32SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??BBxPD?X1=??0C0CΗ5@=)d U5j%5j?~@5wzA.lzZ? |?Q-8>=޶W?0 k8=ޮp? x9=>.ښ?pn5=Yح? Q*=c??b6=Y?T?=>?W!=@-32?Dz=p(?vP(=`?US?>=e?g7=`ŀ'?bͬ/=^s?}#=Jwk?zn=N ָ?LN9=@$"3?5Wg4p6=T?Nv$^)=&?.)<lB?M%=`j?w*= <śm?E2=ެ> ?E=t?? =OQ?w(@ <0?Ac 0=Pyp?dry?=St)?4K >=$?QhBC .=0 ub?-0=?a>-?=?Й,<(lX ?T@b ==P?3h,%=f??# =V ?ߠϡ6=Y?z $=G? $l35=@n?[+3=Rŷ?sdLi==p|?rx"#2=@.?|U2=lԝ?rF=a? 4=Y?sl׼#{ =`~R=?.i1=,? =vX?=p?h}s"= E[ ?%S#[k=7H?j=!V1?}a2=jq?20J5=?5=x¾/@?"B <1=iz?\-!y!=X0z?~b>==:? #.X'=HBO&?(~=xbb? .=Cq?y7i9+= v?:=0 ?2ض8=xPD?X1=??Q?Q?????????]?]?P?P? ? ?U?U?(?(?`?`?_?_?????z?z?1?1?p?p???(e?(e?@#?@#???`?`?hk?hk?,?,?x?x?????N?N?x?x?p?p???~?~?HN?HN???????p?p?Xi?Xi???????????8?8?s?s?pI?pI?&?&?????o?o? *? *???`?`?Z?Z???0?0???PY?PY???`?`???pm?pm?/?/??????5h!>@@Illegal byte sequenceDirectory not emptyFunction not implementedNo locks availableFilename too longResource deadlock avoidedResult too largeDomain errorBroken pipeToo many linksRead-only file systemInvalid seekNo space left on deviceFile too largeInappropriate I/O control operationToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryNo such deviceImproper linkFile existsResource deviceUnknown errorBad addressPermission deniedNot enough spaceResource temporarily unavailableNo child processesBad file descriptorExec format errorArg list too longNo such device or addressInput/output errorInterrupted function callNo such processNo such file or directoryOperation not permittedNo error Complete Object Locator' Class Hierarchy Descriptor' Base Class Array' Base Class Descriptor at ( Type Descriptor'`local static thread guard'`managed vector copy constructor iterator'`vector vbase copy constructor iterator'`vector copy constructor iterator'`dynamic atexit destructor for '`dynamic initializer for '`eh vector vbase copy constructor iterator'`eh vector copy constructor iterator'`managed vector destructor iterator'`managed vector constructor iterator'`placement delete[] closure'`placement delete closure'`omni callsig' delete[] new[]`local vftable constructor closure'`local vftable'`RTTI`EH`udt returning'`copy constructor closure'`eh vector vbase constructor iterator'`eh vector destructor iterator'`eh vector constructor iterator'`virtual displacement map'`vector vbase constructor iterator'`vector destructor iterator'`vector constructor iterator'`scalar deleting destructor'`default constructor closure'`vector deleting destructor'`vbase destructor'`string'`local static guard'`typeof'`vcall'`vbtable'`vftable'^=|=&=<<=>>=%=/=-=+=*=||&&|^~(),>=><=<%/->*&+---++->operator[]!===!<<>> delete new__unaligned__restrict__ptr64__clrcall__fastcall__thiscall__stdcall__pascal__cdecl__based(DwP%%%6$0@P%%%7$ AP%%% 07@(A(p(%Locator failed with option %iLocator succeededTrying %s %s option %iInvalid NILocator_ column "%s"All locator options for %s in %s table failed.Deleted the corrupt NISHAREDDIR64 value from the registry.NISHAREDDIR64Deleted the corrupt NIDIR64 value from the registry.NIDIR64Reading raw value for %s in %s table.Reading path value for %s in %s table.%I64u%lupJM'H[ZHT^`[H_^H_'aPaTPcbHl|@lظ@а@0<@ 4l|4@l\ı̱\@ @DT\@Dعع@Բ@Բ(,4(@xdt|x@d̳<@ ̱@HXd\@H@<<@h,<H|h@,x4@xĵԵ@ĵ< 0<@``p`@`ж@$ж@ܼTdx0ܼ@T(ķ(@@@P`|@@@|@и0 0@PL\l|P@Lp|p@ |@<L\|@<ؾ|ؾ@ܺ@ܺиTdl@T((@@,<D@,t@t̼Լ@H H@P`p @P0 0@ @<LXD@<@0ԾԼ0@Ծ` 0<l`@ l|@lĿԿ @h <h@Mlظ@@$0@`p|@`$$@` `@<LT@<@PP@$,@\lt@\00@h$h@$MTdp$@T$@`$`@8HT$@8@`M@0<@ l|<@l@@@(<@Xht@XM<pp@@@P`@@((@<@,<H@,Xx<X@x@ $4 @HdtH@dM@@TL\lT@L@<@P8HTpP@8PM@@$ 0@$@ XpX@pM@( @ <Xhx(<@Xpp@M\ (@T`(@DD`(D@xx@0MHXd@H@hh@@4D`px@`x@x@ DTdx @D@x@@hxh@4DTx@4@@(8@0hx0@h\\@4|,8|@hx@h,-0Mheee f@f`fffgdgggg#hKhxhh@ixiiij8j{jjjkHkkkTllmHmmino.qrssstuuLvSwxyHyyzKzzz {f{{{@|{|f}4~~p8f 8pȂ8p@hԄ3څ,`HXۊ8~ыIx،>hȍ1aێ[ۏ8h Hxؑ8vQxۓ:jʔ*Z @h@pؗPxؘƚ@pЛhȜ@`(`ʞ0K{X K{"X Kȥ(pЦP8 `ظ 5`e"e"eeee"Dff"@/@.0" @1@2"hXH@9"f","|ffff g"0g8gCgNgYggg"@F4g"XD0g"hh"@h"ph"Dhhh"piii"$pi"0 ?\l(@Z(PYi"?`( Zi" j"80j"d?l( b?ܼ(@b<( ``jhjsj",jj"hܼh"kk"0k8k@k"("pkxkkkkkkk"" l lll)l1l9lDlLl"|llllll"lllmmm0m8m@m"" `pmxmmmmmmmm" mmmnnn'n2n=n=n Hn Sn ^n"'Xnnnnnnnnnn nn n o oooo$o/o:o:oEoPoPo[ofoqoqo|oooo o!o"o#o$o$o"ppp&p1p1p"p","XЌ""0"`""D"p" "P"(rT"dt"Ў"" P"0 "\ Џ" " 0" `" "8 Ȑ"d " @" p" " Б"H "t 0" `k" " ", "X @" p" " Г" "4 0"h `" " " " "DP"p"""" x "Td`""@"dP"08"`h""DЗ""08@H"p""HИ"t""@HS[fny   ę ҙ x"x" (08CNYdr  " (08"`h""4ț"h""@HPX`""H t"Q Z " T"dt "" HP"l "PX"4"XD""r"(8"pO()4+2*6S66759F9"FKLLYYY`lrqcrtsuv^=@|"/8?CJLX hlc=i> ?SDlKKLLTWkp"!""Ɵџܟ@HP"D"""""@&""(#"`#l# \#"##08@HS[cny      ġ̡ԡܡ@"$p"$L"8%|%(%% "%&%%  "P&&@&0&"&*8FTbr£ңx'"''@HP"'"("@("t(@"("(")"<) "p)PX`h")f9)")*&:8*"H*X*:*"**"*@H"+@NP+p"t+`+"+Чا"+",0"<,`kv"h,-V0ld/r0 D-2\/2/2<@/3p/V3,12:~000000011<1L1l11111122,2J2f2X:F:J0<0,00 0/$::b3x33333334.4F4^4v44444444455*5<5L5b5r555555556,6J6^6p6|66666666677.7B7\7t7~777777777888.8<8N8\8n88888889$949H9`9p99999999h:22z::22d0:&3<33N/:g1J ts}yv0qF@LFreeLibrary GetProcAddressGetLastErrorLoadLibraryWLocalAllocLocalFreeKERNEL32.dllMessageBoxWUSER32.dll*RegCloseKeysRegSetKeySecurity[RegOpenKeyExWIsValidSecurityDescriptorSetSecurityDescriptorDacl}IsValidAclAddAceSetSecurityDescriptorGroupCGetSecurityDescriptorGrouppInitializeAclqInitializeSecurityDescriptorDGetSecurityDescriptorLength0GetLengthSidEqualSidGetAceBGetSecurityDescriptorDaclAGetSecurityDescriptorControlNRegGetKeySecuritybRegQueryInfoKeyWSetNamedSecurityInfoWEGetSecurityDescriptorOwnerGGetSecurityDescriptorSaclnConvertStringSecurityDescriptorToSecurityDescriptorWADVAPI32.dllSHGetFolderPathWSHELL32.dllmsi.dllRpcStringFreeWUuidToStringWUuidFromStringWRPCRT4.dll VerQueryValueWGetFileVersionInfoWGetFileVersionInfoSizeWVERSION.dllzWideCharToMultiByteInterlockedIncrementInterlockedDecrementInterlockedCompareExchangeInterlockedExchangeMultiByteToWideChar!SleepInitializeCriticalSectionDeleteCriticalSectionEnterCriticalSectionLeaveCriticalSectionGetCurrentDirectoryWDeleteFileWCCloseHandlehReadFileWriteFileHFormatMessageWGetLocaleInfoWGetCurrentProcessGetModuleHandleWLoadLibraryExWGetModuleFileNameWFindClose$FindFirstFileW\VirtualQuerymGetUserDefaultLCIDfGetTickCountSetLastErrorTQueryPerformanceCounterUQueryPerformanceFrequencySetFilePointerLockResourceLoadResource8FindResourceExW-TerminateProcess>UnhandledExceptionFilterSetUnhandledExceptionFilterIsDebuggerPresentZRaiseExceptionHeapFreeHeapReAllocHeapAllocHeapSizeRtlUnwindGetCurrentThreadIdoGetCommandLineALCMapStringALCMapStringW[GetCPInfo@GetStringTypeWOGetSystemTimeAsFileTimeGetFullPathNameWSetEnvironmentVariableWSetCurrentDirectoryWRGetACPGetOEMCPIsValidCodePage4TlsGetValue2TlsAlloc5TlsSetValue3TlsFree;GetStdHandleGetModuleFileNameAHeapCreateHeapDestroyWVirtualFreeTVirtualAllocExitProcessSetHandleCountGetFileType9GetStartupInfoAJFreeEnvironmentStringsAGetEnvironmentStringsKFreeEnvironmentStringsWGetEnvironmentStringsWGetCurrentProcessIdGetLocaleInfoA=GetStringTypeAEnumSystemLocalesAIsValidLocaleGetModuleHandleAGetCurrentDirectoryAGetDriveTypeAGetConsoleCPGetConsoleModeAFlushFileBuffersLoadLibraryAInitializeCriticalSectionAndSpinCountSetStdHandleWriteConsoleAGetConsoleOutputCPWriteConsoleWxCreateFileAhRegQueryValueExWBRegDeleteValueWIRegEnumKeyExWRpcStringFreeAUuidToStringAUuidCreateoGetSystemMetricsQ;:$;p;"pppP 0@@!<<=7>??;;;;<t=>?n@@@@@    MetaUtilsCA.dllNIFindRelatedProductsNIMUEnsureCorrectFeatureStateNIMUEvaluateNIConditionColumnsNIMUManageWin8InstallTilesNIMUMetaHook?NIMUPersistDepends@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@@Z?NIMUPersistMdfClientAdeInfo@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@@ZNIMUPersistPartRegInfo?NIMUPersistPatchTargetReg@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@@Z?NIMUPersistProdList@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@@ZNIMUProcessNIPathsEnvironmentTableNIMUProductCacheDelete?NIMURegisterMUCustomExecute@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@2@Z?NIMURegisterPartInfo@@YGIPAVMsiSession@@PAVMsiDatabase@@AAV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@2@ZNIMUSetPermissionsNIPathsNIPathsPermanentNIPathsRemoveBackslashNI_MetaToolbox_MetaOutput_GetSharedGlobalDataxhhLL,,P(MACHINE\Software\MicrosoftI.?AVbad_alloc@std@@I.?AVexception@std@@I.?AVfacet@locale@std@@I.?AUctype_base@std@@I.?AVStrictPath@MetaToolbox@@I.?AV?$SmartPtr@VMsiRecord@@@@I.?AV?$SmartPtr@VMsiInstaller@@@@I.?AV?$SmartPtr@VMsiDatabase@@@@I.?AV?$SmartPtr@VMsiView@@@@I.?AV?$SmartPtr@VMsiSession@@@@I.?AV?$IOmegaString@_WV?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@I.?AV?$IOmegaStringCOW@_W@@I.?AV?$ctype@_W@std@@I.?AV?$MsiSmartPtr@VMsiRecord@@@@I.?AV?$MsiSmartPtr@VMsiDatabase@@@@I.?AV?$MsiSmartPtr@VMsiView@@@@I.?AV?$MsiSmartPtr@VMsiSession@@@@I.?AV?$BasicCharPtrOmegaStringCOW@_W@@I.?AV?$OmegaString@PA_W_WV?$BasicCharPtrOmegaStringCOW@_W@@V?$omega_char_traits@_WU?$char_traits@_W@std@@@@@@I.?AVlogic_error@std@@I.KI.?AVinvalid_argument@std@@I.?AVlength_error@std@@I.?AVout_of_range@std@@I.?AVbad_cast@std@@I.?AVOmegaOutOfRange@@I.?AVOmegaMismatchedCOWs@@I.?AVMsiInstallerError@@I.?AV_Locimp@locale@std@@ Copyright (c) 1992-2004 by P.J. Plauger, licensed by Dinkumware, Ltd. ALL RIGHTS RESERVED.I.?AVInstallerError@@I.?AVMsiDatabase@@I.?AVIMsiObject@@I.?AVRefCount@@I.?AVWindowsError@@I.?AVMsiSession@@I.?AVMsiView@@I.?AVMsiRecord@@I.?AVMsiTableInformation@@I.?AVMsiInstaller@@I.?AVDynamicLib@MetaToolbox@@I.?AV?$CallWithNoOptionalArgs@PB_W$1?AddErrorMessageToDebugLog@MetaToolbox@@YAXPB_WZZ@MetaToolbox@@I.?AV?$DynamicFunc@H@MetaToolbox@@I.?AV?$DynamicFunc@PA_W@MetaToolbox@@I.?AV?$DynamicFunc@J@MetaToolbox@@I.?AV?$DynamicFunc@I@MetaToolbox@@I.?AV?$CallWith1OptionalArg@PB_W$1?AddErrorMessageToDebugLog@MetaToolbox@@YAXPB_WZZPB_W@MetaToolbox@@I.?AV?$CallWith2OptionalArgs@PB_W$1?AddErrorMessageToDebugLog@MetaToolbox@@YAXPB_WZZPB_WPB_W@MetaToolbox@@I.?AV?$CallWith2OptionalArgs@PB_W$1?AddErrorMessageToDebugLog@MetaToolbox@@YAXPB_WZZPB_WK@MetaToolbox@@I.?AV?$DynamicSdkFunc@H@MetaToolbox@@I.?AV?$DynamicSdkFunc@PA_W@MetaToolbox@@I.?AV?$DynamicSdkFunc@J@MetaToolbox@@I.?AV?$DynamicSdkFunc@I@MetaToolbox@@I.?AVModuleSearch@MetaToolbox@@xI.?AVMetaOutput@MetaToolbox@@I.?AVPrivateException@MetaOutput@MetaToolbox@@I.?AV?$CallWith2OptionalArgs@PB_W$1?AddErrorMessageToDebugLog@MetaToolbox@@YAXPB_WZZPB_WJ@MetaToolbox@@I.?AVMetaOutputData@MetaToolbox@@I.?AVtype_info@@N@DKM        ! 5A CPR S WY l m pr   )    Muslog10 abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~C@KOQ  `Y4Y Y pXDXXWWWdW,WVVVHV V!U"xTxdTyTTzDT@T0TI.?AVbad_exception@std@@ x [[[[[[[[[[[[[[[|[x[t[p[l[h[d[`[\[X[T[L[@[8[0[p[([ [[ [[ZZZZZZZ .<         @.ccododododododododododpPSTPDT;Zx0Nm:Yw/Mlܧ׹fq @ @6C ??exp/2215h!??  qq|qlqPqc{#Tw=:zc%C101H22`L3`3v$4Rx4L4R5|790<f=j??Av8CE (F0GGLLPTP@WPYn[[\]x^_n_ ``Lada`bJ\bPbHbPDc>cFc2dtthkps,vw @ ̋6 V\LHL$l6įZtRȴRRpDRhpjܶpLHJ84(\ܾth4hFX<t lxJDH:\|xP`VHPPDB(*T.((Z***************** Fehler: %1*** Ende des Fehlerprotokolls**************K*** Fehler: Whrend der Fehlerprotokollierung trat ein weiterer Fehler auf!************** *** Error: %1*** End Error Report**************>*** Error: Additional error occurred while reporting an error!PA***************** Erreur : %1*** Fin du rapport d'erreur**************I*** Erreur : une autre erreur a eu lieu pendant le rapport d'une erreur !PA************** *** 000: %1 *** 0000000B}N************** *** 000: 00000000-Nk0Nn0000L0zvuW0~0W0_00**************: %1 Ӹ ]************** : | XՔ  x յȲ!************** *** %1 *** bJT~_g***************** bJTeSuvQ[0***************** Fehlerdetails:***************** Error Details:***************** Dtails sur les erreurs :PA************** *** 000n0s0}:PA************** 8m:************** *** ~Oo`PAeSiehe folgende Details. (Fehlercode %1!d!) --> WARNUNG - Fehlende Ressource fr diesen Fehlercode!!!1Es wurde kein Fehler gemeldet. (Fehlercode %1!d!)HEin Ausnahmefehler unbekannten Typs wurde abgefangen. (Fehlercode %1!d!)Verwendung dieser Datei9Zur Ausfhrung des Installationsprogramms im Hintergrund:\See details below. (Error code %1!d!) --> WARNING - Missing resource for this error code!!!)No error was reported. (Error code %1!d!):Caught an exception of an unknown type. (Error code %1!d!)How to use this file$To run this installer in quiet mode:PAuVoir les dtails ci-dessous. (code d'erreur %1!d!) --> Mise en garde - Ressource manquante pour ce code d'erreur !!!6Aucune erreur n'a t rapporte. (code d'erreur %1!d!)?Une exception de type inconnue a eu lieu. (code d'erreur %1!d!)Comment utiliser ce fichier1Pour excuter cet installeur en mode silencieux :>s0}o0N N0SgqW0f0O0`0U0D00(000000 %1!d!)--> fJT - S0n0000000n00000L0d0K00~0[00!!!000o00000U00~0[00g0W0_00(000000 %1!d!) Nfj0000n0OYL0iQU00~0W0_00(000000 %1!d!) S0n00000n0O(uel 0quiet mode 0g00000000[LY00el:PA?L 8mD 8pX$. ( Tܴ %1!d!) --> - t TܴX | > h!!! ŵȲ. ( Tܴ %1!d!)"L  Ŕ ЅX x ǵȲ. ( Tܴ %1!d!) t |D XՔ )Quiet ٳ ܴ\ t $X \ ‰X0:PA)N N~Oo`0Nx%1!d! --> fJT - Nx:\nOo`*gbJTNUO0Nx%1!d! Ss*gw{|Wv_8^0Nx%1!d! ,geNO(ue_ec:y!j_ NЏL勉[ň z^+Schwerer Laufzeitfehler. (Fehlercode %1!d!)3Nicht gengend Arbeitsspeicher. (Fehlercode %1!d!)IEine Windows-SDK-Funktion hat einen Fehler ausgegeben. (Fehlercode %1!d!)0Fehler in Laufzeitbibliothek. (Fehlercode %1!d!)PA'Fatal runtime error. (Error code %1!d!)!Out of memory. (Error code %1!d!):Windows SDK function returned an error. (Error code %1!d!))Runtime library error. (Error code %1!d!)PA:Erreur fatale du moteur d'excution. (code d'erreur %1!d!)+Mmoire insuffisante. (code d'erreur %1!d!)DUne fonction SDK Windows a renvoy une erreur. (code d'erreur %1!d!)9Erreur de bibliothque d'excution. (code d'erreur %1!d!)}Tv00000000g0Y00(000000 %1!d!)000 Ng0Y00(000000 %1!d!)&Windows SDKpeo00000ԏW0~0W0_00(000000 %1!d!)0000000000000g0Y00(000000 %1!d!)X΅x Є . ( Tܴ %1!d!)T q. ( Tܴ %1!d!))Windows SDK h | XֈյȲ. ( Tܴ %1!d!)Є |t 췬 . ( Tܴ %1!d!)PA%N͑ЏLe0Nx%1!d! QX[ N0Nx%1!d! Windows SDKQpeԏVN*N0Nx%1!d! ЏL^0Nx%1!d! PAQEin Werkzeug oder eine Bibliothek hat einen Fehler ausgegeben. (Fehlercode %1!d!)ZEin internes Werkzeug oder eine Bibliothek hat einen Fehler ausgegeben. (Fehlercode %1!d!)NFunktionsaufruf oder Kommandozeilenargument ist fehlerhaft. (Fehlercode %1!d!)HFunktionen wurden in falscher Reihenfolge aufgerufen. (Fehlercode %1!d!)iEine Datei, ein Verzeichnis oder ein anderer Bestandteil konnte nicht gefunden werden. (Fehlercode %1!d!)CEingangsdaten einer Quelldatei enthalten Fehler. (Fehlercode %1!d!)GVerzeichnis konnte nicht verschoben werden (Quelle = "%1"; Ziel = "%2")Arabisch7A tool or library returned an error. (Error code %1!d!)AAn internal tool or library returned an error. (Error code %1!d!)CImproper function call or command line argument. (Error code %1!d!)?Functions were called in an incorrect order. (Error code %1!d!)PA file, directory, or other piece of data could not be found. (Error code %1!d!)AInput data from a source data file has errors. (Error code %1!d!)<Could not move directory (source = "%1"; destination = "%2")ArabicPAHUn outil ou une bibliothque a renvoy une erreur. (code d'erreur %1!d!)PUn outil interne ou une bibliothque a renvoy une erreur. (code d'erreur %1!d!)SAppel de fonction ou argument de ligne de commande non valide (code d'erreur %1!d!)MLes fonctions ont t appeles dans un ordre incorrect. (code d'erreur %1!d!)YUn fichier, rpertoire ou autre lment de donnes est introuvable. (code d'erreur %1!d!)bLes donnes en entre d'un fichier de donnes source comportent des erreurs. (code d'erreur %1!d!)IImpossible de dplacer le rpertoire (source = "%1"; destination = "%2").ArabePA$000~0_0o000000L00000ԏW0~0W0_00(000000 %1!d!)&Q000~0_0o000000L00000ԏW0~0W0_00(000000 %1!d!)' NiRj0pe|Ts0QW0~0_0o00000000_peg0Y00(000000 %1!d!)!peL0 Nckxj0^g0|Ts0QU00~0W0_00(000000 %1!d!)0000000000000~0_0o0]0n0Nn0000n0NL0d0K00~0[000(000000 %1!d!)+0000000000K00eg0eQR000k0000L0B00~0Y00(000000 %1!d!)'0000000yRg0M0~0[00 (000 = "%1"; QRHQ = "%2")000&ijl  |t 췬 | XֈյȲ. ( Tܴ %1!d!)) ijl  |t 췬 | XֈյȲ. ( Tܴ %1!d!)(X \ h 8֜  9 |x x. ( Tܴ %1!d!)#޹ JŔ \ h| 8͈֜յȲ. ( Tܴ %1!d!)- |,  Ѭ,  pt0 |ǀ| >D  ŵȲ. ( Tܴ %1!d!)* pt0 |X pt0 % ǵȲ. ( Tܴ %1!d!)$ Ѭ| tٳ`  ŵȲ (="%1"; = "%2")Dō]wQb^Q0Nx%1!d! Q]wQb^Q0Nx%1!d! Qpe(ub}TNLSpe Ncknx0Nx%1!d! Qpe(uz^0Nx%1!d! el~b0ReN0_bvQ[pency0Nx%1!d! npenceNveQpencX[(W0Nx%1!d! elyRvU_n = "%1"; vh = "%2" ?b/OPA#Interner Fehler. (Fehlercode %1!d!)?Es trat ein unbekannter interner Fehler auf. (Fehlercode %1!d!)"Internal error. (Error code %1!d!)MAn internal error occurred for which the cause is unknown. (Error code %1!d!)PA%Erreur interne. (code d'erreur %1!d!)NUne erreur interne dont la cause est inconnue a eu lieu. (code d'erreur %1!d!)PAQ萨000g0Y00(000000 %1!d!) SV Nfj0Q萨000L0zvuW0~0W0_00(000000 %1!d!)x . ( Tܴ %1!d!)'xD L  Ŕ յȲ. ( Tܴ %1!d!)PAQ0Nx%1!d! SuQ SV*gw0Nx%1!d! PA=Verarbeitung zuvor protokollierter Fehler. (Fehlercode %1!d!)PA7Handling previously reported errors. (Error code %1!d!)PA>Gestion des erreurs rapportes plus tt. (code d'erreur %1!d!)"NMRk00000U00_00000Qt-Ng0Y00(000000 %1!d!) t  | ̬iȲ. ( Tܴ %1!d!)YtKNMRbJTv0Nx%1!d! PA*** Abbruch angefordert.*** Abort requested.*** Annulation demande.*** -NeL0BlU00~0W0_00PA***  ̸ ƭŵȲ.PA *** Bl-Nbk0PA?Bei der Erstellung des Debug-Protokolls trat ein Fehler auf: %18Beim ffnen des Debug-Protokolls trat ein Fehler auf: %1,Fehler bei Zugriff auf Ressourcenmodul "%1".LFehler beim Zugriff auf die Registry-Informationen von National Instruments."Fehler bei Zugriff auf Datei "%1".(Fehler bei Zugriff auf Verzeichnis "%1".?Datei konnte nicht kopiert werden (Quelle = "%1"; Ziel = "%2").,Fehler beim Anlegen des Verzeichnisses "%1".,Fehler beim Lschen des Verzeichnisses "%1".2Warnung : Laden der XML-Datei "%1" fehlgeschlagen.(Fehler beim Speichern der XML-Datei "%1"-There was an error creating the debug log: %1,There was an error opening the debug log: %1'Error accessing a resource module "%1".BError accessing National Instruments' information in the registry.Error accessing file "%1".Error accessing directory "%1".8Could not copy file (source = "%1"; destination = "%2").Error creating directory "%1".Error deleting directory "%1".'Warning : loading xml file "%1" failed.Error saving xml file "%1"CUne erreur a eu lieu la cration du journal de mise au point : %1CUne erreur a eu lieu l'ouverture du journal de mise au point : %15Erreur lors de l'accs un module de ressource "%1".RErreur lors de l'accs aux informations sur National Instruments dans le registre.'Erreur lors de l'accs au fichier "%1".*Erreur lors de l'accs au rpertoire "%1".DImpossible de copier le fichier (source = "%1"; destination = "%2")..Erreur lors de la cration du rpertoire "%1".1Erreur lors de la suppression du rpertoire "%1".;Mise en garde : le chargement du fichier xml "%1" a chou.-Erreur d'enregistrement du fichier xml "%1".PA0000000\Ob-Nk0000zvu: %10000000O0k0000zvu: %1000000000"%1"k00000-Nk0000L0zvuW0~0W0_00000000k0B00National Instrumentn0`1Xk00000-Nk0000L0zvuW0~0W0_000000"%1"k00000-Nk0000L0zvuW0~0W0_00000000"%1"k00000-Nk0000L0zvuW0~0W0_00&00000000g0M0~0[00 (000 = "%1"; QRHQ = "%2")000000"%1"0\Ob-Nk0000L0zvuW0~0W0_00000000"%1"0JRd-Nk0000L0zvuW0~0W0_00fJT:xml0000"%1"n0000k01YWeW0~0W0_00xml0000"%1"n0OX[-Nk0000L0zvuW0~0W0_00 \| 1XՔ  ŵȲ: %1 \| Ŕ  ŵȲ: %1 ȴ "%1" XՔ  ./ɤ¸Ҭ National Instruments  XՔ  . | "%1" XՔ  . Ѭ "%1" XՔ  .# |D `  ŵȲ (="%1"; = "%2"). Ѭ "%1"D(|) 1XՔ  . Ѭ "%1"D(|) XՔ  . : "%1"X xml | \) (ӈյȲ."%1"X xml |D ȥXՔ  PA R^Ջe_eQ %1 Sb_Ջe_eQ %1Dn!jWW"%1"eQ0 lQh-NNational InstrumentsOo`eQ0 "%1"eNeQ0 "%1"vU_eQ0el Y6ReNneN = "%1"vheN = "%2" 0 R^"%1"vU_eQ0 Rd"%1"vU_eQ0fJTR}xmleN"%1"1Y%0OX[xmleN"%1"Q0TDateien konnten nicht kopiert werden (Quelle = "%1"; Ziel = "%2"; Neuer Name = "%3");1. Geben Sie Ihre Firmendaten und den Installationspfad an.|2. Fhren Sie folgende Kommandozeile aus: setup.exe <Pfad zu dieser Datei> /q /AcceptLicenses yes. bergabe des Wertes "yes"Uan den Parameter /AcceptLicenses bedeutet die Zustimmung zu den Lizenzvereinbarungen.pAn Stelle von /q kann auch /qb zur Ausfhrung des Installationsprogramms im einfachen UI-Modus verwendet werden.[3. Das Installationsprogramm fhrt nach der Installation automatisch einen Neustart durch. }Zur Vermeidung eines Neustarts verwenden Sie die Kommandozeile : setup.exe <Pfad zu dieser Datei> /r:n /q /AcceptLicenses yesTWeitere Untersttzung erhalten Sie von National Instruments ber www.ni.com/support.Benutzerdaten festlegenWenn der Schlssel SerialNo existiert, aber keinen Wert enthlt, und der Installer den Evaluierungsmodus untersttzt, dann wird dieser per Voreinstellung ausgewhlt.Feature-Optionen festlegen"Gltige Zustnde fr Komponenten: TInstallieren (auf der lokalen Festplatte). Wenn bereits installiert, dann so lassen.=Nicht installieren. Wenn bereits installiert, dann entfernen.=Nicht installieren. Wenn bereits installiert, dann so lassen.r"Standard" bedeutet, die Komponente in dieser Datei nicht aufzulisten. Die Komponente folgt dem Standardverhalten.ICould not copy files (source = "%1"; destination = "%2"; new name = "%3")U1. Edit the information below to match your company information and install location.V2. Run : setup.exe <path to this file> /q /AcceptLicenses yes. Passing the value "yes"Vto the /AcceptLicenses parameter indicates that you agree with the license agreements.TAlternatively, instead of /q, /qb can be used to run the installer in basic UI mode.X3. The installer will automatically restart your system after the installation is done. gTo prevent the restart use the command line : setup.exe <path to this file> /r:n /q /AcceptLicenses yesYPlease contact National Instruments support at www.ni.com/support for further assistance.Set user informationIf the SerialNo key exists but its value is empty, and the installer support an evaluation mode, then an evaluation mode will be selected by default.Set feature statesThe valid feature states are: NInstall it (on the local hard drive). If already installed leave it installed.5Do not install it. If already installed uninstall it.<Do not install it. If already installed, leave it installed.hDefault is equivalent to not listing the feature in this file. The feature follows its default behavior.YImpossible de copier les fichiers (source = "%1"; destination = "%2"; nouveau nom = "%3")v1. Modifiez les informations ci-dessous pour qu'elles correspondent votre socit et l'emplacement d'installation.]2. Excutez : setup.exe <chemin de ce fichier> /q /AcceptLicenses yes. Passer la valeur "yes"Oau paramtre /AcceptLicenses indique que vous acceptez les contrats de licence.[Vous pouvez aussi utiliser /qb au lieu de /q pour excuter l'installeur en mode IU de base.\3. L'installeur redmarrera automatiquement votre systme une fois l'installation termine. rPour empcher le redmarrage, utilisez la ligne de : setup.exe <chemin de ce fichier> /r:n /q /AcceptLicenses yesVeuillez contacter le support technique de National Instruments www.ni.com/support pour obtenir des informations complmentaires.$Dfinir les informations utilisateurSi la cl SerialNo existe mais que sa valeur est vide, et que l'installeur supporte un mode d'valuation, un mode d'valuation sera slectionn par dfaut.%Dfinir les tats des fonctionnalits+Les tats de fonctionnalit valides sont : PL'installer (sur le disque dur local). Si elle est dj installe, la conserver.@Ne pas l'installer. Si elle est dj installe, la dsinstaller.=Ne pas l'installer. Si elle est dj installe, la conserver.La valeur par dfaut revient ne pas rpertorier la fonctionnalit dans ce fichier. La fonctionnalit suit son comportement par dfaut.PA200000000g0M0~0[00 (000 = "%1"; QRHQ = "%2"; e T = "%3")61. O>y`1Xh00000004X@bL0c[U00_00n0h0NW0f0D00S0h00xW0f00N Nn0`1X0}ƖW0f0O0`0U0D0092. [L: setup.exe <S0n00000n000> /q /AcceptLicenses yes"yes"0//AcceptLicenses 00000k0!nY0S0h0g000000QY}k0 TaY00S0h00:yW0~0Y00(~0_00/q n0N00k0/qb 0O(uW0f0W,gUI000g0[LY00S0h00g0M0~0Y00 3. 000000L0[NY00h00000L0Rvk0QwRW0~0Y00 J00000000O(uW0f0QwR0Q00el : setup.exe <S0n00000x0n000> /r:n /q /AcceptLicenses yesC00000_h0U0004XT0www.ni.com/support/ja K00e,g00000000000000000x0#a}W0f0O0`0U0D00000`1X0-[?SerialNo 00L0X[(WY00L0$PL0zzg00000000L0UO00000000Y004XT000000g0UO000L0xbU00~0Y00_jrKa0-[ gRj0_jrKa: -(00000000000k0)000000Y000000000U00f0D004XT0]0n0~0~0k0Y000#000000W0j0D00000000U00f0D004XT000000000Y000 000000W0j0D00000000U00f0D004XT0]0n0~0~0k0Y000.00000g0o0S0n00000k0_j0h:yW0j0D0n0h0 TX0g0Y00_jo000000n0R\O0LD0~0Y00PA/ |D `  ŵȲ (="%1"; = "%2"; tDŽ = "%3")%1. ֬ @ $X X@ |XXij] DŘ | X$.H2. ‰ : setup.exe <path to this file> /q /AcceptLicenses yes. "yes"  ./AcceptLicenses |0 |t< } ٳX\䲔 D ŰȲ.5, 0 UI ܴ $X \D ‰XՔp /q /qbD `  ǵȲ.-3. $X t D̸ $X \t ٳ<\ ¤\D ‘iȲ. Y ‘X J<$t L 9 |xD X$ : setup.exe <path to this file> /r:n /q /AcceptLicenses yesGx ijt DՔXt, www.ni.com/supportX National Instruments 0 8XX$. Ɛ  $GSerialNo tȬX̹ t t Dň $X \t  ܴ| Xt,  ܴ 0<\ )Ȳ. l1 ƌ $ Ǩ\ l1 ƌ Д L Ȳ: .(\ Xܴ ܴ|t ) $XX$. t $X /q /AcceptLicenses yes. O /r:n /q /AcceptLicenses yes7YfY.^R Ǐwww.ni.com/supportT|National Instrumentsb/g/ec0n(u7bOo`%YX[(W^RSFOZur Verwendung der Standardpfade folgenden Abschnitt entfernen/Allgemeine Installationseinstellungen festlegen4Auswahl der den Benutzern nicht zugnglichen DialogeFehler in INI-Datei: %1Set install directories6To use the default paths, remove the following section!Set general installation settings3Set the dialogs that should be hidden from the userError in ini file: %1&Dfinir les rpertoires d'installationCPour utiliser les chemins par dfaut, supprimez la section suivante.Dfinir les paramtres gnraux d'installation;Dfinir les dialogues que l'utilisateur ne devrait pas voirErreur dans le fichier ini : %1PA0000000000000-[00000000O(uY00k0o00N Nn0000000JRdW0~0Y0 N,000000-[0Y00000k0^h:yg0B00y0M0000000-[ini0000g0000: %1 $X  Ѭ $0 \| X$t L 9XD pX$ | $X K $Ɛ  ij] T $ini | : %1PAn[ňvU_YO(u؞_ RdN NRn8^ĉ[ňMnnυ[݋Fh inieN-N%1 Windows 2000 Windows 2000 mit Service Pack %1 Windows XPWindows XP mit Service Pack %1 Windows Vista!Windows Vista mit Service Pack %1 Windows 7PA Windows 2000Windows 2000 Service Pack %1 Windows XPWindows XP Service Pack %1 Windows VistaWindows Vista Service Pack %1 Windows 7PA Windows 2000Windows 2000 Service Pack %1 Windows XPWindows XP Service Pack %1 Windows VistaWindows Vista Service Pack %1 Windows 7PA Windows 2000Windows 2000 Service Pack %1 Windows XPWindows XP Service Pack %1 Windows VistaWindows Vista Service Pack %1 Windows 7PA Windows 2000Windows 2000 D ) %1 Windows XPWindows XP D ) %1 Windows VistaWindows Vista D ) %1 Windows 7 Windows 2000Windows 2000 Service Pack %1 Windows XPWindows XP Service Pack %1 Windows VistaWindows Vista Service Pack %1 Windows 7PAWindows 7 mit Service Pack %1PAWindows 7 Service Pack %1PAWindows 7 Service Pack %1PAWindows 7 Service Pack %1PAWindows 7 D ) %1Windows 7 Service Pack %1PA$Der angegebene Pfad ist zu lang: %1 %The specified path is too long: '%1' PA(Le chemin spcifi est trop long : '%1' c[U00_000L0wY0N0~0Y0: '%1' \ \ 4 AȲ: '%1' PA c[_Ǐ'%1' @Der Pfad %1 ist nicht gltig. Geben Sie einen gltigen Pfad an.@Der Ordnerpfad '%1' enthlt fr Ordnerpfade ungltige Begriffe. 4Der Ordnerpfad '%1' enthlt ein ungltiges Zeichen. IDer Ordnerpfad '%1' enthlt fr die Systemsprache (%2) ungltige Zeichen.PA7The path %1 is not valid. Please specify a valid path.HThe folder path '%1' contains words that are not valid in folder paths. 4The folder path '%1' contains an invalid character. QThe folder path '%1' contains an invalid characters for the system language (%2).DLe chemin %1 n'est pas valide. Veuillez spcifier un chemin valide.VLe chemin du dossier '%1' contient des mots non valides pour les chemins de dossiers. <Le chemin du dossier '%1' contient un caractre non valide. ZLe chemin du dossier '%1' contient un caractre non valide pour la langue du systme (%2).00 %1 o0!qRg0Y00 gRj0000c[W0f0O0`0U0D00 '%1'n0000000k0000g0o0!qRj0ieL0+T~00f0D0~0Y00 '%1'n0000000k0!qRj0eW[L0+T~00f0D0~0Y00 &000000 '%1' k00000%2 g0!qRj0eW[L0+T~00f0D0~0Y00%\ %1t() ǨX JŵȲ. Ǩ\ \| X$.-T \ '%1't() T \ ǨX J@ 貴| hX ǵȲ. &T \ '%1't() ǨX J@ 8| hX ǵȲ. 2'%1'X T \ OSX ¤\ \ Ŵ(%2) ǨX J@ ǵȲ._%1eHe0c[N*N gHe_0eN9Y_'%1'-NS+T_^lW[&{0 eN9Y_'%1'S+TN*N^lW[&{0 eN9Y_'%1'-NS+Tel(uN|~(%2)v^lW[&{0Ordner: Suchen in: Auswhlen &Abbrechen Schwedisch7Der Ordner %1 existiert nicht. Soll er angelegt werden?Erzeugung nicht mglich: %1 %1!Ungltiges Startverzeichnis %1 %2Folder:Look in:Select&CancelSwedish>The folder %1 does not exist. Would you like it to be created?Unable to create %1 %1Invalid initial folder %1 %2PA Dossier :Dans : SlectionnerAnnu&lerSudois9Le dossier %1 n'existe pas. Voulez-vous qu'il soit cr ?Impossible de crer %1 %1 Dossier initial non valide %1 %20000:4X@b:xb 00000(&C)0000000000 %1 o0X[(WW0~0[000 S0n000000\ObW0~0Y0K0?%10\Obg0M0~0[000 %1Rgc[0000L0!qRg0Y00 %1 %2PAT:T 0: ͌(&C)t%1 T tȬX JŵȲ. \ 1XՠȲL?%1D(|) 1`  ŵȲ %1 ǨX J@ 0 T %1 %2PAeN9Yg w bSm(&C)^txQeN9Y%1 NX[(W0 /f&TR^ elR^%1 %1 ^lRYeN9Y%1 %2DeutschEnglisch Franzsisch Japanisch KoreanischNiederlndischPAGermanEnglishFrenchJapaneseKoreanDutchAllemandAnglaisFranaisJaponaisCoren Nerlandais000񂞊0000e,gӗV000PAų|ǴƴՑ´|\m$\ܴ_lewpQPA NorwegischRussisch Portugiesisch ItalienischSpanischDnischPA NorwegianRussian PortugueseItalianSpanishDanish NorvgienRusse PortugaisItalienEspagnolDanois00000000000000000000000000xttǴDŴt,tЬDŴ˜xǴtȹlдPA*cZOaYra'Y)RsYr9NChinesisch (vereinfacht)Chinese SimplifiedChinois simplifiPA!|SO-NVPAm()PA{SO-Ne(4VS_VERSION_INFOOC_?StringFileInfoh040904b0JCompanyNameIBNational Instruments.0@ FileDescriptionalMetaUtilsCA4 FileVersionis3.2.0.3518 InternalNameMetaUtilsCA|,LegalCopyrightCopyright 2003-2013. All Rights Reserved.HOriginalFilenameMetaUtilsCA.dllb!ProductNameftNational Instruments MetaUtilsCAKs0ProductVersion3.2.0@VarFileInfoLo TranslationIn PAPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGO0d0q0001223334 4@4N4^4n4~44444445!5,5M5V5_5v55555555555R6x66687777=8J8o888:7;k>&?8??0X111F8U8888889D9O9_9l9999999: :7:M::::::0;{;;;;;*<6=?@0"00011112M222222K3U3`33333344$4J4U4h4{4444444445#525>5O5X55555555566)696H6s6666667%7H77777778,888=8Z8d8j8o8s====PtS0`0001E11122V2s3335E5c5j55555566*666666S9b99/:O:c:s::::;;);f;};;;#<1<=>>M??`p/0/2O2#424Z4u444556666C7S788839C9p993:C:::c;s;;<<<="=1=]======>Q>b>l>>>>??p 0:0s0000o1t1111$2)282J222222/3v3{33334$434E444444*5q5v55555S6X6o666B7Z777778B8W888C9U9g999999:::::;;;;'>N>^>>>> ?a????0;011M1T1`111122(222333c4s444565R5`55556666666d77#858G888889`9k99999 :#:.:E:::::;;<;;;;j<<<<}===2>>>B?P???0W00)1~11111G2[2w222223`3e333384=44E5[5`55&6+6666O7778888G9L999i:w:|::::: ;;Z;<====>)>L>>> ????|*0i000000t11114445!55.677c7u777777%8j888-999+:0:a:9g>p>~>>>>??01 2232H2s2x2222393D3[3y333334414V4u4z444444#55555%6U66666 7797`7777.838A8W8899<9c9999:$:B::::: ;K;];;;;P>>>?,????/070Y000L1117222$33333?4a4{444444/5X5555566@6627u777 848R88889:999#:5:G:v:::;G;V;k;;;17>_>m>+?S?i?}????200000121j111112K2U2223%3>3K3P3V3\3g3t333414a4}444%5e5u555#6I6_668*8U8~8899+:=:\:m:::::";O;k;;;; <0<<<=K==w>>>>>?Y?h???80O0]001B1e12333344445$575D555E6p6z6666+7X77788A8r8~888888=9c99999#:1:?:t:y:::;&;;[>>>>>?3?V?v???+0|00000011.1i111112242C2U22S3e33c4r4445E55554696@6G6N66717F7R7e7q7777777777M8888888999:::::/;;;; >>>??l0J0n00001c1111*2>2223d33333!4U444444(56P6i66688'99:::::>;;;<=?p000n24(4n44&5n5566*6I6\6i66H7w7777808>8U8g8 9299999:L:Z:;;">? 01O223(353B33333344E4J4w444445?5G556617?7w7G8w88899.99 ::::;< <<$<1<7 >!>2>c>>>>>> ??(?m?z?????0G111!2*2Q2\2 33333 44'4D4\4l4|44444444445/5c5u555C6S6j6667#7:7z7777 8b88889"9M9Y99992:S:d:}::::;;;;;;;;<<"<2c>s>>?&???@0I0W0d0s000111112&22233C3j333344c4s4444<5X5s55566O6666667S7e77858E888D999r::;;r;;;<*#>>>>> ??S?d????Px000031F1o12%2d22334/4s444465H5k5556 6+6^6k6v6666666777777?:::s;;;;;S>f>>>>`L2333 49444'5555C6S666 7888899999;;;;;???p022223#333333444C4V4#555666666677*7f777778%8L8[889&9Z9q99:X:i:::::];h;;;;;;<o>>>X????0:031A1h1x111112!2H2X22222233%3C3Q3j3}333333J4445 575L5c5p555555566'6<6Y6#929[9999:C:c:p::::;7;c;q;;;;;<> ?4?J?V?]?}????? 00<0@0D0H0L00111#232223334(484s444435E5U55566V66667s7778s8889S9a999:!:s:::::#;6;V;];;;< <<<<<< ======c>r>>>>>>?|0;0N000 1<11132e224!4>4466 777777777S8c8w8|88#929F9K999:!:::(;m;<<%<*S>?\0(0Y022223333S4c4w4|445575h577;#;<<<==b====0>6>J>#?3?????00.0:0\00001t1223333b4v5556666777F8888e9y99X:;;6>!>^>|>?"?????@S0`00011c1s1c2p238C8::;;C>> ? c1q133555 66q777@000063H3566667739E9S:e:3t>S?b?n?s000#11122s3333344(4B4556666677&707G7Y7t777777818L8g888888899999:::;&;:;l;;;;* >Y>s>>>>>??6????030B0P001z11112H222@33333464H4k4444455555c6r666667$787r778$8999:X::::;v;;;;;;<>$?C?????? &0H0122[33333)555666666 7p7v7~7777778]8c8t8888`9f9999:8:>:J:::: ;&;;N>Z?????????001080<0@0D0H0L0P0T0000001!1<1C1H1L1P1q11111111111:2@2D2H2L22223 3W3h335 6h66e7j7t777778858e8888999999999,::s;;<v>>>??@1o2222223 3+333_3h3t3333344K4T4`44444 555555566777778N88]999:m::A;X;i;;;;;;;<<>>>>??v????P<B001s2V444 5#5u556U6]67|8 949d9n9z99:k:c>`01%1*10141:1>1D1H1N1R1W1]1a1g1k1q1u1{1112z33333333 434Q4X4\4`4d4h4l4p4t44444465A5\5c5h5l5p5555555666 66Z6`6d6h6l628N8899G:a::::*;;QB???pl00D0h0s00C1f1q1112w2}2222222222"343B3W3a333333%4.44455666889:::=?40002 55555 5$5(58546L6p69:G|0000000000000001 111 1'1/171?1K1T1Y1_1i1r1}11111111142q223 4F4S4]4k4t4~4444444!5X5556-6u667u7777777788&8,858:8I8p888888888 9989>9I9U9j9q999999999999: :::):0:H:W:^:k:::: ;;9;?;[;s;;<6<@>>">'>2>7>D>R>X>e>>>>w?????00"0+0k0p00000 11C1m1122223=3B3P3X3d3k3t333333333333 44 4C4J4c4w4}4444R5r55577777 88 8+8=8P8[8a8g8l8u888888888888889 99989I9O9`99a=m===>E>D0#0+0A0^0011112?2L2_2'3M4Y55>78;; <>>G?R?}??I1122I2d2j2s2z22233!3&363@3G3R3[3q3|33333344F4K4V4[4y455%7,777777S8[88888'9W9i9999:%:0:?:w::::::;<<<<<B>t>>>>>>?y????|n0000000001!1M111r2233333344744E55 6 6f6l6x6N7S7X7]7m77777;8@8G8L8S8X8888?s?????`1 1191111111 2G2I444666 797I7[7o778u8889::;;;f> `3{46m6v666669::;;;;;;<<= =i=q=y=====>>1>=>I>i>>>>>??*??0p>0o00011$1q11`23|3344455&5556677>89:u;;;;<<<==== >*>v>>>>>>>N?`???@00Y133)3G333d444545V55566B7777888/858D8J8Y8_8m8v88888889[9b9h9999999 ::::E;N;c;;H>(>P>PL13z333V456a6q66677N7j7777 8#8R889:@::;<<<%==?`002$5Z5677Y8h88899l::: ;;;;P<<<<<<<<"=+=4=A=g============>#>'>+>/>3>7>;>?>C>G>K>O>>>N?Y???pP(0n0v0000 1%8i999v::::!<<<<1=;=]==>>>>>??'?2?G?N?T?j??H00E3L344v5l6t6'7 888J9P9`9:::;;k>>D?[??4022J6N6R6V6Z6^6b6f6j6n6r6v66^7v777858p?27T9o9999:1;C;U;{;;;;;;< <<#>>>$>*>0>6><>B>H>N>T>Z>`>f>l>r>x>~>>>>>>>>+?:?<0X0\0`0d0w00111 22\335157C7777Y888?9_9w;;;;;;-<8<=9>I>_>r>>>>>+?a?f?u????50P00r11b2222333;4 556:67808G8S8[8c8k8s8{889,9999H:\:::;B;<< =!=s========>>>> >*>K>>>>>>5?M?R?]?b?g???00#090g000000N1S1i1n1}1111111111#2(2-282=2B2M2R2W2b2g2l2z2222222222333/3:3?3L3S3X3v4444p555.6R6a666667787B7O777777"818X8b8o888899::: ;;??#0301&1;1F1w111111>2N2^2222 3a3333D4R44444445%5*555T5g5r5555555556)6q666667E777777 88/888.9:;D;I;T;s;;<(=R=====>P>>>>?C?S?f??? 00`00001S1c1v1122&2p2222 3k33333 4+4K4f4p44444444&505?5f5p55555555&606?66667737B7777778%828S8b88888879E9R999999999:C:N:\:i::::::;;;);S;^;l;y;;;;;;<<,<9B?K?T?]?~????$ 0)0>0[0p0151;1B111111W234 444>4K4V44444505566!62666666G7p8889 9.9;9F99999 : :::;%;2;S;b;;;;;;7> >!>)>.>3>E>K>O>a>j>p>u>>>>>>>>>>>>>>>???2?:???D?V?\?`?w???????????????0 00!0'0+0B0J0O0T0f0l0p000000000000000111#151;1?1V1^1c1h1z111111111111112 22%2-22272I2O2S222222222]33Q4h455556697S7a7899B9M9R9X9b9i9z99999991::::::#;6;z;;U==*??? l%0800012117222D3/44536E6W667'7~77_8s88 989{999;eF>L>>>>>>4?H????0 00/050M0S00000011111111232A2Z22222233S3a3y33333C4V4556b7q777778(828?88888899n9999.:J:::: ;C;Y;k;;;">>A?g????@40111w243B4445q55:$;E;P;&>8>>>?"?/?Pd#0100001&133334c7v7777Z888#9699::$:t:::;R;c;u;;->>????`` 0(0 112P5V5\5z55526R6r666&7v777758]888X9999:J::::%;g;;;y<<"=Z==>pH0S1203\333556q6u78/9d99$:j:::?;x;;>,??01'1J1x1112J2222%3J3333*4R4z4445E555>6r6666*7Z7778-8j889*9999::;J;;;<[<<<<"=P=z=== >C>s>>>?@????0J0z00001Z11112J2222*3c3333"414K4a4{444444 5!5;5Q5k555555526R6z666&7R77778b8888*9:"::;R;;;;/:>>>>>?"?B?]??-0j000152]222223 3333%3+33393A3G3O3U3]3c3m3s3}333333333333333334 44444j444525p5556:66666+7b77778J88888888999 91969@9Q9V9`9q9v9{99999999999999999::::%:1:6:;:E:Q:V:[:e:q:v:{:::::::::::::;;%;/;A;G;K;q;;;;;;;<<)3>?>Y>>>>>>>>???9?T?X?]?q????????? 00!010A0Q0a0q000022222222222222222333 333 3$3(3,383<3<< <<<<< <$<(<,<0<4<8<<<@??? ????? ?$?(?,?0?4?8?P>T>X>\>`>d>h>l>x>>>>>>>>>>>>??????????????0000 00000 0$0(0,0004080000X2\2`2d2h2l2p2t2x2|2222222> >>>(?,?0?4?8?> >$>4>8>H>L>P>X>p>>>>>>>>>>>>>>???,?0?4?>> >(>@>P>T>d>h>l>p>x>>>>>>>>>>>? ?? ?(?@?P?T?X?`?x???????????????0000@0D0T0X0\0d0|000000000000001101@1D1X1\1l1p1x11111111111222 22,2<2@2P2T2X2\2d2|22222222222222233,303@3D3H3L3T3l3|333333333333444$4(4,40484P4`4d4t4x4|4444444444445555(5,50585P5`5d5t5x5|5559999999999:(:H:P:X:`:l::::::; ;0;D;T;d;;;;;;<<<0<<<`<<<<<<<<<<<<<<=0=@=T=\=x=========>(>H>T>t>|>>>>>>>>>>?(?,?4?H?P?X?`?d?h?p????????????000<0H0h0t0000000000000000 11(10181@1L1l1t111111112 2,242<2H2l2222222222233$3,343<3D3L3T3`333333333333334 44 4D4d4l4t4|44444444444445555 5(505<5\5d5l5t5|555555555555555556 666$6,646<6D6L6T6\6d6l6t6|66666666666667777 7(70787@7H7P7X7`7h7p7x777777777777778 888$8,848<8D8L8T8\8d8l8t8|88888888888888899 9(90989@9H9P9X9`9h9|999999999999:::4:<:P:\:d:::::::::::::::::; ;;;$;,;4;<;D;L;T;\;l;t;|;;;;;;;;;;;;< <<<$<,<4<< >>$>,>@>L>T>l>t>>>>>>>>>>>>>>>>>? ???$?,?4?>@>d>p>x>>>>>>>>? ?,?4?(>H>T>t>>>>>>>?$?,?8?t?|????????0$0,0L0`0p000000000011(1H1P1X1d1111111112 2,2L2X2x22222223 333$3,343<3D3L3T3\3d3l3t3333334 4,444<4D4L4T4\4d4l4t4|44444444445 5585@5L5l5t55555556666 6,6L6X666666666 777,787@7X7`77777777788<8D8L8T8h8p8x88888889 99@9T9\9x9999999:$:H:T:\:|::::::;8;X;x;;;;;;;<8>0>P>X>\>t>x>>>>>>>>??4?8?@?H?P?T?\?p????????  0000P0p00000 11,101P1p1111111222 2(20282@2H2P2X2d22222223 3343<3D3T3\3d3h3p3333333333334 444$4,444<4D4L4T4\4d4l4t4|4444444444445$5,545`5h5555555556,646<6D6L6x6666666667 777$7,747<7D7L7T7\7d7l7t7|77777777778$8D8L8X8x8888888889 9@9H9T9t999999999::$:<:D:h:t:|::::::::; ;(;4;\;p;;;;;;;;;< <@0>L>P>l>p>>>>>>>>>>>?(????0H000111202`2222222h3333333T5h5p57>>>$>,>4><>D>L>T>\>d>l>t>|>>>>>>>>>>?? 000000000000000000000000000000000111 11111 1$1(181@1D1H1L1P1T1X1\1`1d1p1111111111111X2\233"3&3`3d3h3l3p3t3x3|333333333333333333333333333333333444 45555555555555555555555555555566 666666"6&6*6.62666:6>6B6F6J6N6R6V6Z6^6b6f6j6n6r6v6z6~66667 777$7,747<7D7L7T7\7d7l7t7|77777777777777::::::::$;`;;`>>???l0@000p111(222X33 4H445T556P666$7X77 8<8p889D9x99:h::::; ;@;h;;;;<0<\<|<<qsuvxz|~hjlntrnwy{} xd8ԗ|p䌬(TPۅș@郾Ȁɀ܅ərԗ|pikmoqsuxz|~39 Tikmoqvxzhjlnpwy deȀɀ<=ikmoqsuhjlntrn SUb~V3;GIJTY^kpqrsv%"+/5.;gp"(9>SUb~Nyy J%% l-t>k#@HdE7Hg@H<AEC/B6fp@H<AE AB